Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G153162-GRMZM5G821988
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.50273886243731
Log2 mRNA fold difference:0.92538058532873
Log2 TE fold difference:-1.4193811514043
Sequences
Protein sequence

MMNNFSKNSETSHFLDSNAVEVRTGTSEPTVQSSNDEGDSDISPETDLAVCNVPLVSSEG
QLKSESRADDQQAAEPTVSVRSVSREKPSVEIARSKSAAGKRKKKKEMLAKADAAGSSDL
YNAYKGPEEKSEMVGTADGADSSSIVDTTHVLLDEAERDVSTFADDCKKKVELDDWEDAA
DMSTPKLAPDSGNQAGTTQVLDSDTSEANSRKKYSRDFLLTLQHHCTGLPVGFQMNEAVN
AIMNNLVGKSYVVDREPYPSPGRGLDRPTSRGDRRGAAMTDDRWTKTGVPLSPGRDVHMD
LPNGTSVVNYRSSGGNHGVLRNPRGQPSNQYGGGLLAGPVHSVGPQVPRSGSDSDRWQQK
GLMPSPVTPMQTMHKAERKYVVGKVSDEEEAKQRQLKGILNKLTPQNFEKLFEQVKEVNI
DSVATLTGVISQIFDKALMEPTFCEMYANFCFHLAGALPDFSEDNEKITFKRLLLNKCQE
EFERGEREEAEADKTEEEGEIKQTKEEREEKRIRARRRMLGNIRLIGELFKKKMLTERIM
HECIKKLFGNCDDPDEENIEALCKLMSTIGEMIDRAKAKEHMDAYFGMMHKMSTSQKLSS
RVRFMLRDSIDLRRNKWQQRRKVEGPKKIEEVHRDAAQERHAQSSRLGRGPAVSSVSRRG
APSMDYGSRGSSALASSSSQQGSIRGMPPHSRGSQDIRYEERNQFDNRTVLPQRVVKDEA
ITLGPQGGLARGMSIRGLSPASNTELPSVIDHRRILSGSNGYNSVTDWTSSSGREDSSSI
IPDRTSGRTSASSQSAGPSQRPASQEGRPGSKSYSEDELREKSVLAIREYYSAKDEKEVA
LCIEELNAPSFYPSVVSLWVNDSFERKDMERELLAKLLVSLCSGRHNLLSKQQLSDGLSS
VLTLLEDTLSDAPRATEYLGRLFARFVEESILLLEEVGKLIQEVGEEPGYLIRDGIAADI
LGAVLDSIKSDKGDSFLNEVKSTSSLKLVDFRPHHLKRSKLDAFM*

MPSPGTPVQAMHKAERKYVIGKVSDEEEAKQRQLKAILNKLTPQNFEKLFEQVKEVNIDS
VATLTGVISQIFDKALMEPTFCEMYANFCFHLAGALPDFSEDNEKITFKRLLLNKCQEEF
ERGEREEAEADKTEEEGEIKQTKEEREEKRIRARRRMLGNIRLIGELYKKRMLTERIMHE
CIKKLFGNHDDPDEENIEALCKLMSTIGDMIDHVKAKEHMDAYFSMMQIMSTNQKLSSRV
RFMLRDSIDLRRNKWQQRRKVEGPKKIEEVHRDAAQERHAQSSRLGRGPAVSSVPRRAHP
MDYGPRGPSASASSSSQQGSIRGMPPHSRGSQDIRHDERHQFDNRTVLPQRVVKDEAITL
GPQGGLARGMSIRGQPPVSNTEIPSVIDHRRIVSSSNGYNSAADWTSSSGREDSNSRLPD
RTSGRIPASSQSAVTSQRPASQEGRSRSKSYSEDELREKSVLTIREYYSAKDEKEVVLCI
EELNAPNFYPFLVSLWVNDSFERKDMERELLAKLLVSLCSGRHNLLSKQQLSDGLSNVLA
SLEDNLSDAPRATEYLGRLLARFVEESILLLQEVGKLIQESGEEPGYLIQGGIAADILGA
VLDSIKSDKGNSFLDEIKTTSSLKLVDFRPQHLKRSKLDAFM*

Other information
Ka divergence:0.159666KaKs divergence:0.0796532
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):3018Length 2 (bp):1929Length divergence:-0.22
MFE 1 (kcal):-930.43MFE 2 (kcal):-580.43MFE divergence-0.232