Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G153184-GRMZM2G160268
Species:maize
Duplication type:WGD
Function (paralog1):LOC100284001
Function (paralog2):Chlorophyll a-b binding protein 4

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.1919733656799
Log2 mRNA fold difference:-0.57069082963099
Log2 TE fold difference:0.36939298716678
Sequences
Protein sequence

MASVTARAPVAALRPSSASLKSSSAFLGHSSRLGRTASPTRRSLKAEAKGEWLPGLPSPS
YLDGSLAGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLIPEVLTKAGLINAP
QWYDAGKSEYFASSSTLFVVEFILFHYVEIRRWQDIKNPGSVNQDPIFKSYSLPPHECGY
PGSVFNPLNFAPTLEAKEKELANGRLAMLAFLGFLIQHNVTGKGPFDNLLQHLSDPWHNT
IIQTFSG*

MASVTARAPVAALRPSSSSAFLGHSSRLGRTATASPTRRSLKAEAKGEWLPGLPSPAYLD
GSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLIPEVLTKAGLINAPQWY
DAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKSYSLPPHECGYPGS
VFNPLNFAPTLEAKEKELANGRLAMLAFLAFLIQHNVTGKGPFDNLLQHLSDPWHNTIIQ
TLSG*

Other information
Ka divergence:0.00311769KaKs divergence:0.276276
GC content 1 (%):66GC content 2 (%):67GC content divergence:0.008
Length 1 (bp):744Length 2 (bp):735Length divergence:-0.006
MFE 1 (kcal):-335.82MFE 2 (kcal):-336.2MFE divergence0.001