Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G153292-GRMZM2G152466
Species:maize
Duplication type:WGD
Function (paralog1):Tubulin alpha-1 chain (Alpha-1-tubulin)
Function (paralog2):Tubulin alpha-4 chain Fragments (Alpha-4-tubulin)

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLIMGRRMQPTTLPVVTTPVIGKEIVDLCL
DRIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVST
SVVEPYNSVLSTHSLLEHTDVAILLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLT
ASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPS
SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQP
PSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFS
EAREDLAALEKDYEEVGAEFDEGEDGDEGDEY*

MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS
VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLVSQVISSLTA
SLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSS
MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP
SVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDLAALEKDYEEVGAEFDEGEDGDEGDEY*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):56GC content 2 (%):57GC content divergence:0.009
Length 1 (bp):1359Length 2 (bp):1356Length divergence:-0.001
MFE 1 (kcal):-524.67MFE 2 (kcal):-530.71MFE divergence0.006