Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G153823-GRMZM5G866082
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC542194
Function (paralog2):LOC100283140

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MSREDNVYMAKLAEQAERYEEMVEYMEKVAKTVDVEELTVEERNLLSVAYKNVIGARRAS
WRIISSIEHKEESRKNEEHVIQIKEYRGKIEAELSNICDGILKLIDSHLVPSSTAAESKV
FYLKMKGDYHRYLAEFKTGAERKEAAESTMIAYKAAQDIALAELASTHPIRLGLALNFSV
FYYEILNSPDKACNLARQAFDEAISQLDTLGEDSYKDSTLIMQLLRDNLTLWTADSTTED
GIEEGNEASKGDAGEGQ*

MSREENVYMAKLAEQAERYEEMVEYMEKVAKTTDVQELTVEERNLLSVAYKNVIAAPRAS
WRIISSIEQKEESRKNEEHVAQIKEYRGKIEAELSNICDGILKLLDTHLVPSSTATESKV
FYLKMKGDYHRYLAEFKTGAERKESAESTMVAYKAAQDIALAELPPIHPIRLGLALNFSV
FYYEIQNSPDKACNLAKEAFDEAISQLDMLGEDSYKDSNLIMQLLRDNLTLWTEDGIEEG
LESSKGDAGEGQ*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):49GC content 2 (%):48GC content divergence:-0.01
Length 1 (bp):774Length 2 (bp):759Length divergence:-0.01
MFE 1 (kcal):-258.2MFE 2 (kcal):-244.44MFE divergence-0.027