Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G154007-GRMZM2G397055
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100273217
Function (paralog2):hypothetical protein LOC100193894

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-3.1056306327989
Log2 mRNA fold difference:-4.3485219529195
Log2 TE fold difference:1.4415133050334
Sequences
Protein sequence

MAEDRSPKPIHCKAAVCRAAGEPLTIEEIVVDPPKAYEIRIRVICTSLCHTDITFWKAKV
APVFPRILGHEAYGVVESVGEHVEGFAAGDTVVPTFLGQCERCASCASEHSNVCDAVPFV
IGPGMRRDGTTRFRDARGSPLHDLLAVSSFSEYTVVDVNQVVKVDPAVPPKLACLLSCGA
GTGVGAAWRSAKVEPGSTVAIFGLGSVGLAVVQGAKMCGASKIIGVDLNPDKEEVGRSFG
VTDFVNPSQLDKRSVVEVIVEMTGGGVDYSFECIGVPSVMTDAFRCTKMGKGKTIVLGLG
RDSDEVCLPSLELLFGRCVMGSLFGGLKPKTHIPVLAKKCMDKELQLDALVTHELGLQDI
NKAFDLLLQGKSLRCILWMDKDK*

MENQGPKPIRCKAAVCRAAGEPLAIEEVVVDTPKAHEVRIRIICTSLCHSDVTFWRMKDL
PDNIPRIFGHEAFGVVESVGEQVDEFAAGDAVVPTFLGQCSECVDCRSARSNMCSKYRFA
VRPGMPRDGTTRFTDGQGRPLHHFFGVSSFAEYTVVDVNQVVKLNPAVPPALACLLSCGA
STGVGAAWKQAKVEPGSSVAIFGLGAVGLAVAEGARICGASKIIGVDINPEKCELGKKFG
VTHFINPKELGEEKPVHQAIAEMTDGGADYCFECIGLAALMNDAFRSSRDGWGKTIILGV
EMHGAPLCISPHEILHGKSVIGSMFGGVKPKQDIPILADKYMNKELELDKFITHEVGLKD
INQAFDLLLQGKSLRCTIWMDK*

Other information
Ka divergence:-0.213311KaKs divergence:-0.0446895
GC content 1 (%):64GC content 2 (%):61GC content divergence:-0.024
Length 1 (bp):1152Length 2 (bp):1149Length divergence:-0.001
MFE 1 (kcal):-538.76MFE 2 (kcal):-482.5MFE divergence-0.055