Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G154151-GRMZM2G112366
Species:maize
Duplication type:WGD
Function (paralog1):LOC100280989
Function (paralog2):LOC100285983

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

RPDPVARTLAGLRFPSRDSTLLPFHSRALLFSSLRCRPTSGAQFSIFGPFSSDEHPPGPI
HLTRIFCISGSWQRIMDWLGQKRAEMLMQVLLVASAVVAFLVGYVRADFQLMLLVYAGGV
VLTALVTVPNWPFYNRNPLKWLDAAEAERHPRPQVSAAPAAGGKKRSGKNK*

MDWLGQKRAEMLMQVLLVASAVAAFLVGYVRADFQLMLLVYAGGVVLTALVTVPNWPFFN
RNPLKWLDAAEAERHPRPQVSAGAAAGGKKKSGKNK*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):63GC content 2 (%):66GC content divergence:0.023
Length 1 (bp):516Length 2 (bp):291Length divergence:-0.279
MFE 1 (kcal):-211.94MFE 2 (kcal):-126.9MFE divergence-0.251