Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G154320-GRMZM2G362627
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100382144

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.1696217688556
Log2 mRNA fold difference:-0.87733910705851
Log2 TE fold difference:0.68626269006772
Sequences
Protein sequence

MSSSNSPCAACKLLRRKCTQGCVFAPYFPPDNPGKFASVHRVFGASNVSKLLNDLDQLQR
EDAVNSLAYEADARIRDPVYGCVAYISVLQMKIKRVRDEIANARKELAAYIGTAAFAPYV
ATPQYHHHQYAAGAVPLAVGVGPQHGHPHHQQQQIMVHQHLHHQQQMAAAAEVQQQLAVA
VEVAREQDLMMRQAAVYAHAVPSGGPTVAVVPPDALPYEGGFLFQQQPPPSQAQTAVALT
YQMEQSPPSSSSGQSHPEVSQQHNTDGSDEGSGGGGVVPPA*

MSSSNSPCAACKLLRRKCTQGCVFAPYFPPDNPAKFASVHRIFGASNVSKLLNDLPAVQR
EDAVNSLAYEAEARIRDPVYGCVSHISVLQVRIRQVRDELVAARKELAAYIGPAAFTPFV
ATPQQYHHQYAAGAGGGVPLATGMGLAVGVGPQPHQQHGHPHQQQMMAHGQHLHHQHHLM
AAAEAQQQLALAAQVAREQDVMMRQAVVYAHAVPGSGATVAVGPPDAVPYEGGFLFQQQH
HQQPPSQAQTTVALTYQMEQSPPPSSPGQSHSHPEVSQQKNTDGSDEGSGGGGLVPPPA*

Other information
Ka divergence:0.1364KaKs divergence:0.242537
GC content 1 (%):68GC content 2 (%):68GC content divergence:0
Length 1 (bp):846Length 2 (bp):900Length divergence:0.031
MFE 1 (kcal):-403.4MFE 2 (kcal):-424.7MFE divergence0.026