Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G154328-GRMZM2G088648
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100277122
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MGKGGGEEDGAAAAARAAEQARELQDAAAALLTQTRAEEEALRRRAAALQGELRRLREAA
AAHADSDKVEEDLDRAACLIAEGDVASLLPSKTQGAFLKMFLGPVNLRATRKEVQLKVKE
EYNSYRDRTALLFLCFPVILLFLRQWLWNGCFPVLPVQLYQAWLLFLYTSLALRENILRV
NGSDIRPWWILHHYCAMLMSLVSLTWEIKGQPNCARKQRGVELFLCWAIMQGFVMMLQNR
YQRQRLYTRIALGKAKRMDVVWGETAGVEGQLLLLCPLLFLLQGFEGYVGFLLLRTAHTG
VVPEWQVVVCGILLIAMAIGNFANTVDTLVTKSRFKAKMKKSKGRRDLDTCPSPTGSSSP
IDSATTKA*

MSEEERKGGGGGGDDGAAAAARAAEQARELQDAAAALLTRTRAEEEALRRRAAALQGELR
RLREAAAAHADSEKVEEDLDRATCLITEGDVASLLPSKTQGTFLRMFLGPVNLRAPRKEV
QLKVKEEYNSYRDRTALLFLGFPVILLFLRQWLWNRCFPALPVQLYQAWLLFLYTSLALR
ENILRVNGSDIRPWWILHHYSAMLMSVISLTWEIKGQPNCARKQRGVELFLCWAIMQGFV
MMLQNRYQRQRLYTRIALGKAKRMDVVWGETAGVEGQLLLLCPLLFLLQGFEGYVGFLLL
RTAHTGVVPEWQVVVCGILLISMAIGNFANTLDTLMAKSRFKAKMKKSKGKRDLDTCPSP
TGSSPTDSATRA*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):54GC content 2 (%):53GC content divergence:-0.009
Length 1 (bp):1107Length 2 (bp):1119Length divergence:0.005
MFE 1 (kcal):-434.4MFE 2 (kcal):-431.8MFE divergence-0.003