Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G154332-GRMZM2G475683
Species:maize
Duplication type:WGD
Function (paralog1):SAUR12 - auxin-responsive SAUR family member
Function (paralog2):LOC100280867

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-2.9493597955234
Log2 mRNA fold difference:-2.8155702553323
Log2 TE fold difference:-0.21417681408104
Sequences
Protein sequence

MLQHGEEKKGKVKKGWLAVRVGAAEGDGSQQRFVIPIAYLYHPQFRRLLEAARDAYGYDY
SAGPLRLPCSADEFLRLRALVEREAQAPSSSSSHHHRVHAGGGSHGGHYSLSSPCTRARV
TS*

MLHAEEKKGKVKRGWLAVRVGAAEGDGGSQRFVIPIAHLYHPLFRRLLEAARDAYGYDYS
AGPLRLPCSADEFLRLRALVERETPPHAAPAPASSHRVHEGGHYSTLSPCTRAKVTS*

Other information
Ka divergence:0.220495KaKs divergence:0.348525
GC content 1 (%):73GC content 2 (%):73GC content divergence:0
Length 1 (bp):369Length 2 (bp):354Length divergence:-0.021
MFE 1 (kcal):-193.3MFE 2 (kcal):-171.96MFE divergence-0.058