Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G154397-GRMZM2G125635
Species:maize
Duplication type:WGD
Function (paralog1):S-adenosylmethionine decarboxylase proenzyme Precursor (AdoMetDC)(SAMDC)(EC 4.1.1.50) [Contains S-adenosylmethionine decarboxylase alpha chain;S-adenosylmethionine decarboxylase beta chain]
Function (paralog2):S-adenosylmethionine decarboxylase proenzyme

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAVLSAADASPVSAIGFEGYEKRLEITFSEAPVFVDPHGRGLRALSRAQIDSVLDLARCT
IVSELSNKDFDSYVLSESSLFIYPLKIVIKTCGTTKLLLTIPRILELAEELSMPLAAVKY
SRGTFIFPGAQPAPHRSFSEEVAALNRYFGGLKSGGNAYVIGDPARPGQKWHVFYATEYP
EQPMVNLEMCMTGLDKKKACVFFKTNADGNTTCAKEMTKLSGISEIIPEMEICDFDFEPC
GYSMNAIHGSAFSTIHVTPEDGFSYASYEVMGLDATALSYGDLVKRVLRCFGPSEFSVAV
TIFGGRGHAGTWGKALGAEVYDCNNMVEQELPGGGLLVYQSFCAAEDAVATSPKSVFHCF
DGENVESAPPPMKKDYKLANLLCWEEEADAMEEKAGVLDE*

MAVLSAAGAPPASAIGFEGYEKRLEITFSEAPVFVDPHGSGLRALSRSQIDSVLDLARCT
IVSELSNKDFDSYVLSESSLFIYPLKIVIKTCGTTKLLLTIPRILELAEELSMPLAAVKY
SRGTFIFPGAQPAPHRSFSEEVAVLNRYFGGLKSGGNAYVIGDAARPGQKWHIYYATEYP
EQPMVNLEMCMTGLDTKKASVFFKTNADGNTTCAKEMTKLSGISEIIPEMEICDFDFEPC
GYSMNAIHGSAFSTIHVTPEDGFSYASYEVMGLDATALSYGDLVKRVLGCFGPSEFSVAV
TIFGGRGQAGTWGKELGAEAYDCNNMVEQELPGGGILIYQSFCAAEDAVASSPKSVLRCF
DGENAAPFAKDCKLANLVCLEEVGCYRGEGWSA*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):52GC content 2 (%):53GC content divergence:0.01
Length 1 (bp):1203Length 2 (bp):1182Length divergence:-0.009
MFE 1 (kcal):-438.6MFE 2 (kcal):-433.62MFE divergence-0.006