Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G154489-GRMZM2G168706
Species:maize
Duplication type:WGD
Function (paralog1):Calcium-dependent protein kinase 2 (CDPK 2)(EC 2.7.11.1)
Function (paralog2):calcium-dependent protein kinase

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.69913302695098
Log2 mRNA fold difference:-0.89708478775468
Log2 TE fold difference:0.20012779243797
Sequences
Protein sequence

MGQCCSRATAPDSGRGGANGYGYSNQAKPAQAPPSYNPPQQAAEVRYTPSATNSSAVPPV
AVPPKPTADTILGKQYEDVRSVYSLGKELGRGQFGVTYLCTEIASGRQYACKSISKRKLV
SKADREDIRREIQIMQHLSGQPNIVEFRGAYEDKSNVHVVMELCAGGELFDRIIAKGHYT
ERAAATICRAVVNVVNICHFMGVMHRDLKPENFLLATKEENAMLKATDFGLSVFIEEGKM
YRDIVGSAYYVAPEVLRRSYGKEIDVWSAGVILYILLSGVPPFWAETEKGIFDAILHEEI
DFESQPWPSISESAKDLVRKMLTRDPKKRLTSAQVLQHQWLREGGEASDKPIDSAVLSRM
KQFRAMNKLKKMALKVIASNLNEEEIKGLKQMFMNMDTDNSGTITYEELKAGLAKLGSKL
SEAEVKQLMEAADVDGNGSIDYVEFITATMHRHKLERDEHLFKAFQYFDKDNSGFITRDE
LESALIEHEMGDTSTIKEIISEVDTDNDGRINYEEFCAMMRGGMQQPMRLK*

MGQCCSRAPAPDSGRGGTNGYGYSNQAKPAQTPSSYNPPQQPAEVRYTPPATNPPVVPPV
PVPPKPTADTILGKQYEDVRSVYSLGKELGRGQFGVTYLCTEVASGKQYACKSISKRKLT
SKADREDIRREIQIMQHLSGQPNIVEFRGAYEDKSNVHVVMELCAGGELFDRIIAKGHYT
ERAAATICRAVVNVVNICHFMGVMHRDLKPENFLLASKEENAMLKATDFGLSVFIEEGKM
YRDIVGSAYYVAPEVLKRSYGKEIDVWSAGVILYILLSGVPPFWAETEKGIFDAILHEEI
DFESQPWPSISESAKDLVRKMLTRDPKKRLTSAQVLQHSWLREGGGASDKPIDSAVLSRM
KQFRAMNKLKKMALKVIASNLNEEEIKGLKQMFMNMDTDNSGTITYEELKAGLAKLGSKL
SEAEVKQLMEAADVDGNGSIDYVEFITATMHRHKLERDEYLFKAFQYFDKDNSGFITRDE
LESALIEHEMGDTSTIKEIISEVDTDNDGRINYEEFCAMMRGGMQQPMRLK*

Other information
Ka divergence:0.163231KaKs divergence:-0.998114
GC content 1 (%):49GC content 2 (%):49GC content divergence:0
Length 1 (bp):1596Length 2 (bp):1596Length divergence:0
MFE 1 (kcal):-553.91MFE 2 (kcal):-548.5MFE divergence-0.005