Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G155329-GRMZM2G119186
Species:maize
Duplication type:WGD
Function (paralog1):Chalcone--flavonone isomerase (Chalcone isomerase)(EC 5.5.1.6)
Function (paralog2):hypothetical protein LOC100275381

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAVPEVVVDGVVFPPVARPPGSAGSHFLGGAGVRGLEIGGNFIKFTAIGVYLEDAAVPAL
AKKWGGKTADELASDAAFFRDVVTGDFEKFTRVTMILPLTGEQYAEKVTENCVAFWKAAG
LYTDAEGVAVEKFREVFKPETFAPGASILFTHSPAGVLTVAFSKDSSVPAAGGVAIENKR
LCEAVLESIIGERGVSPAAKLSLAARVSELLAKETAAPADAPQAEPVSITA*

MAVPEVVVDGVVFPPAARPPGSAGSHFLGGAGVRGLEIGGNFVKFTAIGVYLEDAAVPAL
ARKWAGKTAGELASDAAFFRDVVTGERLREVSRGVTMIRPLTGEQYAGKVAENCVAYWKA
AGLYTDAEGVAVEKFKQVFKPHTFPPGASIHFTHSPAGVLTVAFSRDSSVPVAGGVAIDN
KLLCEAVLESIIGEHGVSPAAKLSLAARVSELLTKGTAAAAAALRAEPVSVTA*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):70GC content 2 (%):70GC content divergence:0
Length 1 (bp):696Length 2 (bp):702Length divergence:0.004
MFE 1 (kcal):-360.1MFE 2 (kcal):-373.7MFE divergence0.019