Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G155464-GRMZM2G050803
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100277051

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MPLTRVAADAFGVLTIALFALFAALGLFCIFQSVYFRCRIRRGPSFLPLGYFNGPWVTRI
ALILITIWWGVGEIVRLSFLKKKLFSSLTWQRNICDVYILSNLGFAEPGIFFAFAFLLHG
SLQKRELGTLNQRWNWKTMAYLLVFCIPVFSVQAILVFVGPRFVREENHDLGRRKIAKYF
IRTYTPVGDTSVCTYPLFGTLFLGLVDAFLMSYVSYVGLRVLSLVINKSLRRRVYLLMLS
VLCFLPIRVLLLGFSVLLKPGHVAFEGIIFLSFLMMLSCTTVGILLLVYYPVADSLALRD
IGQRDIAEMVPYDDYYYEGTSLVANQSFREIERNSDTSTKPGSIXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXFSPKLA*

MPLTRVAADAFGVLTIGLLALLAALGLFCIFQSVYFRCQIRRGPSFLPLGYFNGPWVTRV
ALVLITIWWGVGEVARLSFLKQKLFSSLTWQRNICDAYILSNLGFAEPGIFFAFAFLLHG
SLQKKELGTLNQRWNWKSMAYTLVFCVPVFSVQAVLVFVVGPRLVRDSNHDLGRRKIAKY
FVRTHTPVGDTSVCTYPLLGTIFLGLVDAFLMSYVSYVGSRALSLVINKSLRRRVYLLML
SVLCFLPTRVLLLGFSVLPRPGDAAFEGIVFLSFLTMLSCTAVGILLLVYYPVADSLALR
DMGQRDTAAEMVPYDDYYCYEGASLVANRSFRELERNSDTSTKPGSISFRTMIREDQLQQ
DGAADEIGFSSRSGAHIGSPSPAGSSPSAAMPMLPVKEIPRY*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):47GC content 2 (%):58GC content divergence:0.105
Length 1 (bp):1155Length 2 (bp):1209Length divergence:0.023
MFE 1 (kcal):-333.74MFE 2 (kcal):-492.87MFE divergence0.193