Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G155525-GRMZM2G160064
Species:maize
Duplication type:WGD
Function (paralog1):LOC100282516
Function (paralog2):metal ion binding protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.57699899418203
Log2 mRNA fold difference:-0.71810497023727
Log2 TE fold difference:1.3117411109429
Sequences
Protein sequence

MAPLLFRDMKGLSCSSPASTAICPSLERQPMVRPHKAIASASPLSHVPAAPRTHRHDGKK
GRQQEEQQQRKAVVVGNAGGLVSPAGSSRYLLSGRFAATEEIQEVESAPAVDVKPKREEA
GEAAADAKSAQAQEQAQEQVVVLKVSLHCKACAGKVKKHLSKMEGVTSFNIDFAAKKVTV
VGDVTPLGVLSSVSKVKNAQLWAAPPAIAA*

MAPLLFRDMKGLSCSSQASTATCPSLERHPAPRPHKASAGASPLAPVPAAEPRTRTHRLD
GKKGQQPQHKAAVVPANAGGGLVSPAGSSRYLLLSGRFAAVAEEIQEVLEPAPAVDAIAK
REEASDAADAKTAQAQEQVVVVLKVSLHCKACAGKVKKHLSKMEGVTSFNIDFAAKKVTV
VGDVTPLGVLSSVSKVKNAQLWAAPPAIAAA*

Other information
Ka divergence:0.334361KaKs divergence:0.283655
GC content 1 (%):66GC content 2 (%):68GC content divergence:0.015
Length 1 (bp):633Length 2 (bp):636Length divergence:0.002
MFE 1 (kcal):-299.62MFE 2 (kcal):-311.6MFE divergence0.02