Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G155767-GRMZM5G833140
Species:maize
Duplication type:WGD
Function (paralog1):histidine kinase
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.30754452283147
Log2 mRNA fold difference:1.0120423842189
Log2 TE fold difference:-1.3367480385684
Sequences
Protein sequence

MGVGGGGGGGGEAAAVSAPAPAEEAGKDAEDGSGWTLKAKLIAVAVLVWVLGALALGVFL
HSYFRHAALRKAEEGLVSMCEERARMLQDQFAVSVNHVHALAILVATFHYEKRPPALDQN
TFADYTARTSFERPLLSGVAYAQRVVHGDRESFERQQGWIIKTMKHEPSPVQDEYAPVVY
SQETVSYIEGLDMMSGEEDRENILRSRASGKAVLTRPFRLMSNHLGVVLTFPVYHVDLSS
DAKEEDRVAATAGYLGGSFDVESLVENLLRQLAGNQELVVNVYDVTNSSNPLVMYGSEVS
LGNPSPSHICMLDFGDPFRKHHMVCRYRNKPQLPWSAISSSSGVFVICMLVGYIVGAAWS
RYDNVKEDCRKMEELKKQAEAADVAKSQFLATVSHEIRTPMNGVLGMLDMLLDTDLTSTQ
RDFAQTAQVCGKALISLINEVLDRAKIEAGKLDLESVPFDLRSILDDVISLFSSKSREKG
IELAVYVSERVPELLLGDPGRFRQIITNLVGNSIKFTERGHIFVQVHLADHSNLATEPKV
ESVANGMNGHKDEKTAVATSVSLNTLSGFEAADSRNSWENFKLLLSYEKNEMPYESVSDK
VTLVVSVEDTGIGIPLDAQAKVFTPFMQADSSTSRTYGGTGIGLSISKCLVELMGGQINF
VSRPHVGSTFTFTAALQRCDRSAIGDSKPVMLHPLPSSFKGLSALLVDRRPVRATVTKYH
LQRLGIACDVVATIELALGVLSGRNGSSLTSTKQPCMLLIESDSWGFKIDVPLRSRLLEM
KQNGPPGLPKTILLAAAESGKLKAHYAVDSVITKPLKASGLAACLFQTLGITQSSNERRD
NSGSLHGLLLGKNILVVDDNKVNLRVAAGTLKKFGAKVECVESGKDALASLQVPHKFHLC
LMDIQMPEMDGFEATKQIRAMEAKANEQAVACDDSETDGATRAARWHLPVLAMTADVIQA
THEECTKYGMDGYVTKPFEEKQLFQALQKFLDPGMSS*

MPLLKWSFSLLGFFMCPCGLRAVRTRVICRYRLLFGRFVCRLEALLSVDLFVLQNTFADY
TARTSFERPLLSGVAYAQRVVHADREGFERHQGWIIKTMKHEPSPAQDEYAPVVYSQETV
SYIEGLDMMSGEVCGDVSRSFLADGLQLFSAGVGSEPGCVSVVLQEDRENILRSRASGKA
VLTRPFRLMSNHLGVVLTFPVYHADLPSDAKEEDRVAATAGYLGGAFDVESLVENLLRQL
AGNQELVVNVYDVTNISNPLVMYGSEVPLGNPSPSHICMLDFGDPFRKHHMVCRYRNKPH
VPWSAISTPSGVFVICMLVGYIAGAAWSRYDNVKEDCRKMEELKKQAEAADVAKSQFLAT
VSHEIRTPMNGVLGMLDMLLDTDLTSTQRDFAQTAQVCGKALISLINEVLDRAKIEARKL
DLESVPFDLRSILDDVISLFSSKSREKGIELDVYVSERVPEILLGDPGRFRQIITNLVGN
SIKFTERGHIFVQVHLADHSNLATESKVEPVANGMNGHTDEKTAVATSVSLNTLSGFEAA
DSRNSWENFKLLLSYEKNEMPYESVSDKVTLVVSVEDTGIGIPLDAQAKVFTPFMQADSS
TSRTYGGTGIGLSISKCLVELMGGQINFVSRPHVGSTFTFTAVLKRCDRSAIGDSKPVML
HPLPSSFKGLSALLVDRRPVRATVTKYHLQRLGIACDVVATIELALGVLSGRNGSSLTSM
KQPCMLLIESDSWGFNIDVSLRSRLLEMKQNGHTHVLPKIILLAAAESGKLKEHYAVDSV
ITKPLKASALAACLFQTLGIKQSSNERSDNSGSLYGLLLGKNILVVDDNKVNLRVAAGTL
KKFGAKVECVESGKDALALLQVPYKFHLCLMDIQMPEMDGFEATKQIRAMEAKANEQAVA
CDNSEIDGATRAARWRLPVLAMTADVIQATHEECTKCGMDGYVTKPFEEKQLFQALQKFL
DPGMSC*

Other information
Ka divergence:0.435844KaKs divergence:0.10115
GC content 1 (%):50GC content 2 (%):47GC content divergence:-0.031
Length 1 (bp):2994Length 2 (bp):2901Length divergence:-0.016
MFE 1 (kcal):-1103.24MFE 2 (kcal):-993.3MFE divergence-0.052