Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G155911-GRMZM2G455075
Species:maize
Duplication type:TD
Function (paralog1):anthocyanidin 3-O-glucosyltransferase
Function (paralog2):Anthocyanidin 5,3-O-glucosyltransferase

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.55903995190674
Log2 mRNA fold difference:0.22334919818935
Log2 TE fold difference:-0.79525421650407
Sequences
Protein sequence

MAAPTVVLLPVWGAGHLMSMLDAGKRLLTRGGRALSLTVLVMRAPTEQLAADLDAHIRRE
EASGLDVRFVRLPAVQPPTDFHGIEEFISRLVQLHAPHVRAAISSLASPVAAVVMDFFCT
ALLDVTRELAVPAYVYFTASAGMLAFFLRLPSLHEEVTVQFEEMEGAVDVPGLPPVPPSS
LPVPVMDKNHPNYTWFMYHGRRFAEADGIIVNTAAELEQSVLAAIADGRCTPGVRAPTVY
PIGPVISFSPPPTNTEHPHECVRWLDTQPAASVVLLCFGSQGFSAAPQAHEIAHGLERSG
HRFLWVLRGPPAPGERHPSDANLSELLPDGFLERTKGRGLVWPTKAPQKEILAHAAVGGF
VTHGGWNSVLESLWFGVPMAPWPLYAEQHLNAFTLVAYVGVAVAMKVDRKRNNFVEASEL
ERAVKELMGGGEEGRKAREKAMEMRDACRNAVEEGGSSYSSLRRLSEKICKVDKNL*

MPSPTIVLLPMWATGHFSSMLEAGKRLLFCSAGRTAAYSLTVLVTPPPMAASSEASSSQQ
AHCEMMATVDGIVFHHLPAIEHRTDLAHPSEYIRLYAPQVKEAIAGLAAPVAAVVVDFFG
TPLLDVAHDLAVPAYVYFASTGAMLALMLRLPGIQEELASRLREEGGVVDVPGMPPVPVA
SMPSPDVNDYTWFAYYGRRFLETRGIIANTAAELEPGVLASIAGGRCTPGGRAPTVYPIG
PVLSPKPRVVVDARSSSSAQECIRWLDAQPPASVVFLCFGSMGWMNAEQAREVAAGLERS
GHRFLWVLRGPPAGSGSGHPTDANLGDLLPDGFLERTKAQGVVWPGWAPQLEILAHAAVG
GFVTHCGWNSVLESLWHGVPMAPWPLYAEQPLNAFELVACMGVAVDLRVVGTGRASSVVE
AAELERAVRSLMGGSEEGRKAKEKARKMKAACRKAAEKGGSAYAALQAVVQDMLESHVPG
TAPK*

Other information
Ka divergence:0.104758KaKs divergence:-0.00170213
GC content 1 (%):66GC content 2 (%):67GC content divergence:0.008
Length 1 (bp):1431Length 2 (bp):1455Length divergence:0.008
MFE 1 (kcal):-690.81MFE 2 (kcal):-736.71MFE divergence0.032