Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G156016-GRMZM2G449165
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100280171
Function (paralog2):vascular plant one zinc finger protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:2.5895585036142
Log2 mRNA fold difference:2.7007685136204
Log2 TE fold difference:-0.10637276901636
Sequences
Protein sequence

MGKVPSSRAGSRHQQFRARAMTRVDDLQEVFSGLQSARKDSRPTDAAILEAQLQQMLREW
RSELSAPSPASSLQGNARELSDPPSDTLRMLQLAAAEEEDDATSKMVEQQQQPPPPANQN
QGHAQVCQDMKREPREEAVDVAVEKPQPLSQGVLLNGAATASAVFHDQELTVEDFLYDDD
YKIDLSGSNLDVLNNLEGIVQLEYPQLNLPQELAPNVYIDMSYCGQNAGGVLLHMTDLFT
TMTSAPSAFLKPKCALWDCPRPAVGSERWHDYCSMYHADLAVQEEGPPGTMPVIRPRGID
LKDGPLFAALSAKIQGKNVGIPICEGAATAKSPWNAPELFDLYIFEGESIREWLFFDKPR
RAFVSGNRKQRSLPDYGGRGWHESRKQAMKDFGGLKRSYYMDPQPSNSYEWHLYEYEINE
CDAFALYRLEFKSSDAKKIVKSKLACNPLNEIQQQMVRLSADSPVDNKRTARGRQHANPT
DVDTNIYSVPNTTAQANVPNAYQPGSQVDQMTYLNGSVVYGPHLPYGYSTERSDFYWNSA
DGT*

MTHETTAVSVSRCYWTALSALTSTDALIRMLGPAVAFPKAADPDDDPTKWQPENSAEHLA
CETKDGAPEEGKGKQPPRPRPFRSTSTRAQRSRRRMRMRMGKGPSSRAGSRHRQFRARAM
TRVDDLQEVFSGLQSARKDSRSADAAVLEAQLQQMLREWRSELSDPSPASSLQGNARELS
DPPSDTLRLLQLVVAEEEDDATSKMVEQQQQQPPPPLPANRSQGHAHVVCQGMKPEPREE
AVDVAVDQPQLLSQGVLPNGAATASAMFHDQLYYVNQELTVEDFLYDDDYKIDLSGSNLD
VINNLEGIVQLEYPDHNLPQGLAPNAYLDMNSCGQSAGAVFLHMPDLLTTMTSAPSAFLK
PKCALWDCPRPAIGSERWHNYCSMYHADLAVQEEGPPGTMPVIRPRGIDLKDGPLFAALS
AKVQGKNVGVPICEGAATAKSPWNAPELFDLYIFEGESIREWLFFDKPRRAFDSGNRKQR
SLPDYNGRGWHESRKQVMKDFGGLKRSYYMDPQPSNGYEWHLYEYEINDCDAFALYRLEF
KSSDAKKIAKSKLGCNPLNEIQQQMDRLSADSPVDTKRTARSRTEPNPIDVNTNIYSVPN
TTVQTDVPNAYQPGSQVDQMTYLNGSVVYGPHLPYGYSTERSDFYWNSNDGT*

www.000webhost.com

Other information
Ka divergence:0.0126449KaKs divergence:0.00865074
GC content 1 (%):52GC content 2 (%):54GC content divergence:0.019
Length 1 (bp):1632Length 2 (bp):1959Length divergence:0.091
MFE 1 (kcal):-592.86MFE 2 (kcal):-755.1MFE divergence0.12