Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G156019-GRMZM2G319187
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100280379

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-2.0604737058959
Log2 mRNA fold difference:-0.37945747795068
Log2 TE fold difference:-1.618260029297
Sequences
Protein sequence

MTVPDAESRFHVLAVDDSLVDRKLIEMLLKTSSYQVTTVDSGSKALELLGLRDASSPSPS
SPDHQEIDVNLIITDYCMPGMTGYDLLKRVKGSSSLKDIPVVIMSSENVPARISRSAPDR
IQF*

MTVLDAESRFHVLAVDDSIIDRKLIEMLLKSSSYQVTTVDSGNKALELLGLRDNGAEDAS
PPSSSSSSSSSSSPDHQEIDVSLIITDYCMPGMTGYDLLKRVKGSSSLKDIPVVIMSSEN
VPARISRCLQDGAEEFFLKPVKPADMKKLKSHLLKRKQPNQKNKPQAQAVESPEQQLDPH
PQPVHEPEEAAADRNGVNKRKAAAMEEGLTVVVTAPESTKPRRLSTSSLTVET*

Other information
Ka divergence:-0.310559KaKs divergence:-0.226254
GC content 1 (%):58GC content 2 (%):61GC content divergence:0.025
Length 1 (bp):372Length 2 (bp):702Length divergence:0.307
MFE 1 (kcal):-135.7MFE 2 (kcal):-291MFE divergence0.364