Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G156486-GRMZM2G169365
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100280276
Function (paralog2):hypothetical protein LOC100279870

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.2577351934929
Log2 mRNA fold difference:0.50940003260135
Log2 TE fold difference:-0.71251801658285
Sequences
Protein sequence

MRAAAAATSTAAALLAPGLKLCAGGARARVSCPSRSRLPLHRIAAMASAPNPSFRPEEAR
SPPALELPTPPLSKFKVALCQLSVTADKNRNIAHARAAIEKAASEGAKLVLLPEIWNGPY
SNDSFPEYAEDIEAGGDAAPSFSMMSEVARILQVTLVGGSIAERSGNNLYNTCCIFGSDG
KLKGKHRKIHLFDIDIPGKITFKESKTLTAGQNPTVVDTDVGRIGIGICYDIRFQELAML
YAARGAHLLCYPGAFNMTTGPLHWELLQRARATDNQLFVATCGPARDTSAGYVAWGHSTL
VGPFGEVIATTEHEEATIIAEIDYSLIEQRRQFLPLQHQRRGDLYQLVDVQRLGSH*

MVAAAAAAAAATATATATATAAALLAPGLKLCAGRARVSSPSGLPPRRVTAMASAPNSSF
RPEEARYPPALELPIPRLSKFKVALCQLSVTADKSRNIAHARAAIEKAASDGAKLVVLPE
IWNGPYSNDSFPEYAEDIEAGGDAAPSFSMLSEVARSLQITLVGGSIAERSGNNLYNTCC
VFGSDGQLKGKHRKIHLFDIDIPGKITFKESKTLTAGQSPTVVDTDVGRIGIGICYDIRF
QELAMLYAARGAHLLCYPGAFNMTTGPLHWELLQRARAADNQLFVATCAPARDTSAGYVA
WGHSTLVGPFGEVIATTEHEEATIIADIDYSLIEQRRQFLPVQHQRRGDLYQLVDVQRLG
SQ*

Other information
Ka divergence:0.0631845KaKs divergence:0.0960378
GC content 1 (%):54GC content 2 (%):55GC content divergence:0.009
Length 1 (bp):1071Length 2 (bp):1089Length divergence:0.008
MFE 1 (kcal):-392.21MFE 2 (kcal):-392.21MFE divergence0