Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G156638-GRMZM2G311051
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100304314
Function (paralog2):hypothetical protein LOC100217185 (LOC100217185), mRNA

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.5141920164321
Log2 mRNA fold difference:0.69357588105242
Log2 TE fold difference:0.82254766211051
Sequences
Protein sequence

MLGQNLYELLKRNHLRGLKLKYVQAFSKQILDAMVVMREAGIIHCDLKPENILLAPSVTT
AAEVKVIDFGSACLEGKTVYSYIQSRYYRSPEVLLGYPYTTAIDMWSFGCIVAELFLGLP
LFPGASEYDVLQRMMKILGGQPPDELLREAKNTARFFKHVGSIYPGNEAPTGLCSAYKSL
SEEDVEVRDSKKPQMGKWYFPHLKLDKLICTYPWNNSELTETEKMDRLGLVDFLKGLLEF
DPNKRWSPLQALYHPFITGKSFTGPYEPVPETTRIPVVRAAAIDHNPGGGHWLHSGLSPQ
VGSVNRYLPSNNAYPPKVPFSYGSSYGSFGSHGSYTANAGFGNSYGSIGDVNAINMYYSP
LSSSGLTQIGSSPDVRLRMLLPHDRGIRLSPGSLGPMSLGASPSQFTPPNYQMQIPANSV
GKHGSGSPASGGIHGSPLGKSAGVGPYNMRRNLPMPPHDYVSQHGHGRCGDGVSFSHFDA
CARGHTGHSHSAAGPSSYHSGWRPQIGSRSGISLEASSSHVLSQAPSQSFDFSPSSALDP
ANWDPNYSDESLLQDNSLSAELSSNLHFGDATGQGSGSIRSANFQGHVFATSNPVPTNQR
ADQLFHVSSQGLSAHSSVPVNYGGYNPPNYPPQNLRPRRGQPILHQRYNQATSSPMRPMG
SHHSGQPAWPSFGMGDGVPWGGTGGHSFTTSGLSSSLARKDYGSIF*

MVKILGGQPPDELLREAKNTVRFFKHVGSIYAGNAAPIGLSSAYRILSEEEVEARDSKRQ
KMGKWYFPHLKLDRLICTYPWNNSELAETEKTDRLGLVDFLKGLLEFDPNKRWSPLQALH
HPFITGESFTGPYEPIPETARIPVARAAAIDHNPGGGHWLHSGLSPQVGSVNRYLPLNNV
YPPKVPFSYGSSYGSFGSHGSYTGNAGFGNSYGSIGDANAINMYYSPLGSSGLTQIGPSP
DVRLRMRLSHDRGIRLSPGSLGPMSVGASPSQFTPPNYHMQIPANSTGTHGSGSPASGVI
HGSPLGKAAAVGPYNMRRNLPMPPHDYVSQHGQGRFRDGVSFSHSDACAQGHTGHSHNAA
VPSSYHSGWRPKIGSRSGISLEASSSHVPSKAPSQSFDFSASSTLDPANWDPNYSDESLL
QEDNSLSADLSSNLHFGDATGQDHIFATSNPVPTNQRGDQLFHVSSQGVSAHSSVLINYG
GYNPQNYPQQNARPRHGQPILHQRYNQATSSPMRPMGSHHNGQPAWPSSFGMGDGVPWGG
TRGHSFTTRKDYGSIF*

Other information
Ka divergence:0.0499057KaKs divergence:0.117905
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):2121Length 2 (bp):1671Length divergence:-0.119
MFE 1 (kcal):-674.4MFE 2 (kcal):-523.06MFE divergence-0.126