Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G156734-GRMZM2G118957
Species:maize
Duplication type:WGD
Function (paralog1):protein binding protein
Function (paralog2):protein binding protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MGDHVAVDVGELVASRVGEAAGLVSGAKEETEALIGMVECRICQEEDLRKNLESPCACNG
SLKYAHRECVQRWCNEKGDTICEICHELYKPGYTAPTQVHHDETTIEISGGDWTISGNRL
DLHDPRILAMAAAQHRLLEDDYDEYTATNNNAAAFCRSIFLILMALLLLRHTLTITNSDD
EDDASAIFSLFLLRAAGFLLPCYIMAWAISIMQRQRQRQEEAMLLPTEVAIILHRNGRTM
QFAVAPPETPISPHPELNQ*

MGDHVAVDVGELVASRVGEAAGLLSGGKEEMKALAGMVECRICQEEDLAKNLESPCACSG
SLKYAHRECVQRWCNEKGDIICEICHESYKPGYTAPTQVHHDETTIEISGGDWTISGNRL
DLHDPRILAMAAAQHRLLEDEYDEYTATNNNAAVFCRSIFLILMALLLLRHTLTITNSDD
EDDASAIFSLFLLRAAGFLLPCYIMAWAISIMQRQRQRQEEAMLLPTEVAIILHPDGRTM
QFAVAPAESPASHQ*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):49GC content 2 (%):49GC content divergence:0
Length 1 (bp):780Length 2 (bp):765Length divergence:-0.01
MFE 1 (kcal):-255.27MFE 2 (kcal):-250.4MFE divergence-0.01