Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G156756-GRMZM2G138421
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100272505
Function (paralog2):hypothetical protein LOC100191441

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MEAARFGARSSHLYGSGLGELDLNRRESRVFGWDLNEWSWDSQRFTATPVPVEAANGSGL
NSSPSSSEEAGEEMAKNGGLGGDTDKRKRAVVIDDDDDDETEDQDTVVNGGGSLSLIIGG
SAAGAGAMENGDVNEDERNGKKIRVQGGGSSGPACQVEGCGADLTAAKDYHRRHKVCEMH
AKATTAVVGNTVQRFCQQCSRFHLLQEFDEGKRSCRRRLAGHNKRRRKTRPDTASCGTAS
IEDKISNYLLLSLIGICANLNSDNVQHSNGQELLSTLLKNLGSVAKSLEPKELCKLLEAY
QSLQNGSNAGTSGTANATEEAAGPSNSKLPFVNGSHCGHASSSVVPVQSKATIVVTPEPA
SCKLKDFDLNDTCNDMEGFEDGQEGSPTPAFKTADSPNCASWMQQDSTQSPPQTSGNSDS
TSTQSLSSSNGDAQCRTDKIVFKLFDKVPSDLPPVLRSQILGWLSSSPTDIESHIRPGCI
ILTIYLRLVESAWQELSENMSLHLDKLLSSSTDNFWASGLVFVMVRRRLAFMLNGQIMLD
RPLAPSSHHYCKILCVKPVAAPYSATINFRVEGSNLLSTSSRLICSFEGRCIFQEDTDSV
AENDEYEDRAIECLSFCCSVPGPRGRGFIEVEDSGFSNGFFPFIIAEKDICFEVSELESI
FESSSIEHADANDNAREQALEFLNELGWLLHRANRMSKENVTDTSVATFSMWRFRNLGVF
AMEREWCAVIKMLLDFLFIGLVDVGSRSPEEVVLSENLLHAAVRRKSVNMVRFLLRYRPN
KNSKGTAQTYLFRPDALGPSMITPLHIAAATSDAEDVLDVLTDDPGLIGISAWSNARDGT
GFTPEDYARQRGNDAYLNLVQKKIDKHLGKGRVVLGVPSSICSVITDGVKPGDVSLEICM
PMSASVPGCLLCSRKARVYPNSTSRTFLYRPAMLTVMGVAVVCVCVGILLHTFPRVYAAP
TFRWELLERGPM*

MEAARFGTQSSHLYGGGLDLNRREKRVFGWDLNDWSWDSQRFVATPVQQQAANGSGLNSS
PSSSEEAVEEVARNGGFRGDTDKRKRVIDDDETEDQCTVLHGGRSLSLKIGGAAGGVGAM
ENSDVNEDNERNGKKVRVQGGSSSGPACQVEDCGADLAAEKDYHRRHKVCEKHAKASTAV
VGNTVQRFCQQCSRFHLLHEFDEGRRSCRRRLAGHNRRRRKTRPDTAIGGTASIEDKVSN
YLLLSLIGICANMNSDNAQNANGQELLSTLLKNLGSVAKSLEPKELCKFLEAYQSLQNGL
NAGTSGIANGAEEAAGPSNSKLPSVNDSHYGQASSSVVPVQSKATTVVTPEPASCKLKDF
DLNDTCIDMEGFEDGQEGSPTPAFKTADSPNCASWMQQDSTQSPPQTSGNSDSTSTQSLS
SSNGDTQCRTDKIVFKLFDKVPSDLPPVLRSQILGWLSSSPSDIESHISPGCIILTVYVR
LVESAWQELSENMSLLLGKLLNSSTDDFWASGLVFVMVRHHLAFMLNGQIMLDRPLAPSS
HHYCKILCVRPVAAPYSATINFRVEGFNLLSTSSRLICSFEGHCIFHEDTDSGAENVEYK
DRDIECLSFCCSVPGPRGRGFIEVEDSGFSNGFFPFIIAEKDVCAEVSELESIFESSSNE
HANARDQALEFLNELGWLLHRANRMSKEDETDTSLAPFNMWRFRNLGVFAMEREWCAVIK
MLLDFLFIGLVDVGSRSAEEMVLSENLLHAAVRRKSVNMVRFLLRYKPNKNSKGTAQAYL
FRPDALGPSKITPLHIAAATSDAEDVLDALTHDPGLIGISAWSNARDETGFTPEDYARQR
GNGAYLNLVQKKIDKHLGEGHVVLGVPSSICPVITDGVKPGDVSLEICRAMSASVPGCLL
CSRQARMHPSSTARTFLYRPAMLTVMGVAVVCVCVGILLHTFPRVYAAPTFRWELLERGP
M*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):2919Length 2 (bp):2886Length divergence:-0.006
MFE 1 (kcal):-988.09MFE 2 (kcal):-1006.61MFE divergence0.009