Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G156824-GRMZM2G025127
Species:maize
Duplication type:WGD
Function (paralog1):serine/threonine-protein kinase Cx32 (LOC100281330), mRNA
Function (paralog2):serine/threonine-protein kinase Cx32

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MGNICGGCGKDRVAEDFRPSSPGTTMTSKTSGSITTTSQSTTGKLSSVGSSFMASAGSRS
TSGGFDEGAKYPDGGQILEAPNLRTFTFMELKTATKNFRLDSVLGEGGFGTVYKGWVDEK
TMTPTRNGTGMVVAVKKLNSESMQGYEEWQSEINFLGRLSHPNLVKLLGYCWEDRELLLV
YEFMAKGSLENHLFRRGCAPLSWELRLKIAIGAARGLAFLHASEKQVIYRDFKASNILLD
ANYNAKLSDFGLAKLGPTGSKSHITTRVMGTYGYAAPEPFVREERRVRLRRGDAGDAVRA
ARAGPEPAERAAEPGRLGEAVPGRPPEAGPAHGPAVRGAVQLEAGVPGGAADAQLPGRRA
PQPAVDEGGGGDAGADRVGEEQGAGGARRLVAGPAPRPRRRDAPAVAARRWRAARPRWVP
GRRQRPRRQGRRAVTRPDDDDSSCKWRFFFA*

MGNICGGSGKDRVAEDFRPSSPGTTMTSKTSGSITTSLSTTGKLSSVGSSFMASASSRST
SGGFDEGAKYSDGQILEAPNLRTFTFVELKTATKNFRPDSVLGEGGFGRVYKGWVDEKTM
APTRNSTGMVVAVKKLNSESMQGFEEWQSEINFLGRLSHPNLVKLLGYCWEDKELLLVYE
FMAKGSLENHLFRRGCAPLSWELRLKIAIGAARGLAFLHASEKQVIYRDFKASNILLDAN
YNAKLSDFGLAKLGPTGSNSHITTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVMLEML
SGQRALDPNRPSGQLSLADWAKPYLADRRRLARLMDPRFEGQYNSRQAFQAAQLTLGCLA
GDPRSRPSMKEVVETLERVEAVKSRARGGGSGSGSGRAGAAAHHRSPRVGGGARAASRPA
ANGHNARPAR*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):62GC content 2 (%):63GC content divergence:0.008
Length 1 (bp):1356Length 2 (bp):1293Length divergence:-0.024
MFE 1 (kcal):-595.47MFE 2 (kcal):-580.28MFE divergence-0.013