Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G156827-GRMZM2G021483
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAPAKRKRAAAAAAAAAAAAAKWKVGDLVLAKMKGFPAWPAMISEPEQWKMPSTKKKPLV
YFYGTKQIAFCNYADLEAFTEEKKRSLLAKRHGKGADFLRAVDEIIEVYDSLKEKGSNKD
DLAAEVKPGVEKFADNNVCMDTENMVSSSYIQNHQEIDDHYVTTKGHDMIKSDRLSVTIM
SDERCVINSAPDEPTENVSVLDEMREISLRTNSFSNKQRDAQPQNCYTRSRVPSLRKSRS
SISVESRKAQGSGNFFDHTNLSSIGSVPNENKERSSRHRHADDKANSGSVSILDNVWLHS
GRGTSNQPVTLGTTCNGSKMLNPPVKADSTCNSEASENGTSETELKSNGTSNLPMNTEVI
FRRIRKSDRKPVPHYEDCTTPNKDELRAEYSEILSDSPNSKNEVCKSDGDEHLPLVKRAR
VRMGRSHLEDSPVDEVDVSNKKPELTTTSDQCDRNGKPASPVNDYSADQVSTVVSSASNP
SCKSDMPILSKEGHLPWKNKEYHPKILALDVEAALPPSKRLHRALEAMSANVAENVKNIP
EVTGPNEMALNGSLLTANNHSNKSADAVVTVSNKPVIVQCSEPSLDTQFKHTQSGKCTSE
STLQNNTIPDSASVPSKENDIMLKENDTNGSWVCSELDNGSCGKTSALCMILNRPGLDVT

MAPAKRKRAAAAAAAAAAAKWKVGDLVLAKMKGFPAWPAMISEPEQWKMPSTKKKPLVYF
YGTKQIAFCNYADLEAFTEEKKRSLLAKRHGKGADFLRAVDEIIEVYDSLKDIGSNKVDL
PAEEVKPGVEKFAENNSRMDTEDLVSSSYMHNDRKIEDHYVTTRSHDMVNSDRPSVDERC
VVNSAPDEPIENVSILDEMRDISLRTNSFSNKQRDAQPQNCYTRTRVPSLRKSRSSLSLE
SRKAQGSGNFFDHTNLASINLVPGEHKEPSHHRHEDDKANSSSVSTSDNVWLHSGEGTSN
QPVTLGASNGNRMLNTPAEVDSTSNREASENGTTETELKSNGTSDLPMNTAVNFKRKRKS
DRKPGPHYRDCTTPNKDDQLCAEYSEILPDSPNSKNEVSKSDGDEHLPLVKRARVRMGRS
QLEDSPVDEIDVSNKKPELATALDQCDRNGKPASPANDYSADQVSAVVSSAPNLSCKLDT
TILSKEGHLPWKNKEYHPKILALDVEAALPPSKRLHRALEAMSANVAENTKNIPEVTGPN
EMTLNGSLLTASSLSNKSADAVVTVSNRPVIVQSPEPSLDTQFVHNPSGKCTSESILQNN
SIPDSASVPSKENDHIVLKGDICEETLMDTKTANGSWDCSELNNDSCGKTSALCMKLNRP
ALNVTQATSVPDRLSSSLEKASENVAASGVKETKTFGSAVCDVDRSAEPIDRSNNNVTSN
TMRHSETIVADSVNNMSAFEIAYAKLGLCDDLRPRRIHATSFCWHGFRLPLEQRFYKTQE
YPSMKKFYEVLIASLCFAIFAHGFRHTFSSLALKELNHRKIKDRSTSPDSMPMKELIAVA
QARRFSRSTSFPDNFLNAKYIPETSINIPSKEGPHRQLSPSNRIIRSTSGNDNVNSRSPF
DNIQQKKLAAHGANAARRSFKDFLSTLTRTKESISRATRLAMECAKFGIAGEAIDIIVEH
LEKESNLYKRVDLFFLVDSITQCSRNQKGGAGDVYPSLIQAVLPRILYAAAPPGNSAWEN
RKQCLKVLKLWLERKTLSEYIIRHHIREIETINEASFGSSRRPSRTERALNDPLRDNEGM
LVDEYGSNAGFQLPNLICTKVLEEEEENSSEGRSLSFEAVTPEQDAPYNDDNEESQMPVE
KHHHILEEVDGELEMEDVAPPSDIGATTKCQPEQSDTNRAPSDQRPSDAGPPLPVDRPPS
PPPLPSSPPPVPVPQSAQMQPKLQMASDPMAPHPQRATYSVQSQQQHSIAEHPVQDMEGN
KIRYHLPHQWHHSILLVPMAVSLLPQHLTMGTTIIGLQPHPCLTRDIISNHHPLHRLQIN
SLLCHQNTNIGHITGVITVHRIPRDIGTMDMIEVITDMIEGIMDMTDNTIMMIEDTTTMI
EDITMMIEAITLMIEDIILTIEDITLMRELLGGQCTMMPLTREDILFLQVLLGFLTILKL
HQPQCTMGDHQILRQGLVQAGLGRLGYLITILPRDILWSLQFHIQLEVMVDGDLDNLFRY
RSGALMLSLVCGGLTCGRVCLVSLLQVEGTHGGGALQESGSWYLPPCTDVSHGFYGGRAA
*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):41GC content 2 (%):44GC content divergence:0.035
Length 1 (bp):1980Length 2 (bp):4683Length divergence:0.406
MFE 1 (kcal):-580.13MFE 2 (kcal):-1422.29MFE divergence0.421