Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G156848-GRMZM2G121743
Species:maize
Duplication type:WGD
Function (paralog1):LOC100285900
Function (paralog2):LOC100282321

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAGKGGSTNLEKEQMFGMAEKEMEYRVDLFNRLTQTCFNKCIEKRYKEAELNMGENSCID
RCVSKYWQVTNLVGQMLGNRPQM*

MAGKGGPTNLEKEQMFGMAEKEMEYRVDLFNRLTKTCFEKCVEKRYKEAELNMGENSCID
RCVSKYWQVTNLVGQMLGNQPQM*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):44GC content 2 (%):46GC content divergence:0.022
Length 1 (bp):252Length 2 (bp):252Length divergence:0
MFE 1 (kcal):-67.6MFE 2 (kcal):-69.91MFE divergence0.017