Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G157157-GRMZM2G159777
Species:maize
Duplication type:WGD
Function (paralog1):translocon of outer membrane of chloroplast35
Function (paralog2):translocon at outer membrane of chloroplast34

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.52221988529867
Log2 mRNA fold difference:-0.18035528343131
Log2 TE fold difference:0.69954283046936
Sequences
Protein sequence

MASPIPREWVGLQQFPAATQTKLHELLGKLKEEDVSTLTILVMGKGGVGKSSTVNSIVGE
RVASVSAFQSEGLRPMMCSRTRAGFTLNIIDTPGLIEGGYINEQAVDIIKRFLLGKTIDV
LLYVDRLDAYRMDTLDEQVIRAITNSFGKDIWRRSLVVLTHAQLSPPDGIDYNDFFTRRS
EALLRYIHSGAGINKREYGDFPLPIALVENSGRCKTNEHGEKILPDGTLWVPNLMKEITV
VISNGSSPTHVDQKLIDGPNPNNRRKLFIPLILAVEYFLVVKGIRRAIHADIANGKVDDW
EQRYRDLVGSRDLVEQKGSTSRNRKA*

MASPIPREWVGLQQFPPATQTELHELLGKLKEEDVSTLTILVMGKGGVGKSSTVNSIVGE
RIATVSAFQSEGLRPMMWSRTRAGFTLNIIDTPGLIEGGYINEQAVDIIKRFLLGKTIDV
LLYVDRLDAYRMDTLDGQVIRAITNSFGKDIWRRSLVVLTHAQLSPPDGIEYNDFFTRRS
EALLRYIHSGAGIKKREYGDFPLPIALVENSGRCKTNEHGEKILPDGTPWVPKLMKEITV
VISNGSKPIHVDQKLIDGPNPNNRWKMFIPIILAVEYFLVVKGIRRAIHADIANGKVDDW
EQRYRDLVGSRDPVEQKGSTTRNRKA*

Other information
Ka divergence:0.157193KaKs divergence:0.235136
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):981Length 2 (bp):981Length divergence:0
MFE 1 (kcal):-325.8MFE 2 (kcal):-320.17MFE divergence-0.009