Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G157246-GRMZM2G300589
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191157
Function (paralog2):hypothetical protein LOC100276856

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MTEAAVTRYWCHGCVRVVEEAMGEEIKCPFCGGGFIEEMIGEEFDGLASQQSERDSSQWG
ASNNPFEQPRAEADSEDEEDDDDYDDDIGRAFESFIRRHGRPSALRRAFDSIQDDLRADR
DSDFSILINAFNQALALQRSVLDADEARDDQGGSSNDDGLMEEYVLGAGLTLLLQYLTEN
DPSQYGTPPANKEAVDALPTVQIAEAVSCSVCLDDLELGSQAKQMPCEHKFHSPCILPWL
ELHSSCPVCRFELPSEETEDLDEPSNVDRTENTHEEVRADGPEDDSESSNRAWALVPWFS
GLFSTPEPQTVRGAFTDQQTRSTSGTNMNAGES*

MTEAAVNTRYWCHGCEKVIEEAMVGEDIKCPFCGGGFIEEMAGEDSEGLQLEREWGTPPG
DSEDDDDDDIAHEFEGFIRRHGRASALRRVLDSIQDDLRADRERDNSVLINAFNQALASQ
GSALLDADEARDGRGGSSNSNDDGLLEEYDVLGAGLSLLLQHLAENDPNRYGTPPAKREA
VEALPTVQIAEAVSCSVCLDDLELGSPAKQMPCGHRFHSSCILPWLELHSSCPVCRFELP
SEETKDLNEPSDVHRRTESTRENDSESGNSAWPLVPWFFSGLFSVPEPSHTDRGTLTTDQ
QSPSTNPNAGGN*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):51GC content 2 (%):60GC content divergence:0.081
Length 1 (bp):1002Length 2 (bp):939Length divergence:-0.032
MFE 1 (kcal):-345.99MFE 2 (kcal):-380.23MFE divergence0.047