Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G157329-GRMZM2G166780
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100279524
Function (paralog2):hypothetical protein LOC100272743 (LOC100272743), mRNA

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.1868598005792
Log2 mRNA fold difference:-0.27452102465133
Log2 TE fold difference:-0.93303929445645
Sequences
Protein sequence

MAETLDMTLDDIIKNNKKSNPSSGGARRSRGGSAPGGGSGGVGPTRRSFKRAGNRQAPYQ
PPKAPDAAWQHDMYPAVAAGGGGGGRVSALETGTKLYISNLDFGVSNDDIKELFSELGDL
KRFSIIYDRSGRSKGTAEVVFARRSDAVAAVKKYNNVQLDGKPMKIEIVGTNTPTASAAL
PVSNGGHARNAVRSAPRGAAPAGVPQRRPHQRGGRRSGGSGGGRRGKERSKPKSAEELDA
DLEKYHADAMQTN*

MAETLDMTLDDIIKNNKKSNPSSRGARRSRGVSAPGGGTGGVGPTRRPFKRAGNRQAPYQ
PPKAPDAAWQHDMYPAVAAGGGGGGGRVSALETGAKLYISNLDFGVSNEDIKELFSELGD
LKRFSINYDRSGRSKGTAEVVFARRSDAVAAVKKYDNVQLDGKPMKIEIVGTNTPAAAAA
HPVPNGGHARNAARSAPKDAAPAGMSQHRTHQRGGRRAAGSGGGRRGKERSKPKSTEELD
ADLEKYHADAMQTN*

Other information
Ka divergence:0.426077KaKs divergence:0.358591
GC content 1 (%):59GC content 2 (%):57GC content divergence:-0.017
Length 1 (bp):762Length 2 (bp):765Length divergence:0.002
MFE 1 (kcal):-318.2MFE 2 (kcal):-314.05MFE divergence-0.007