Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G157510-GRMZM2G358931
Species:maize
Duplication type:WGD
Function (paralog1):cyclin dependent kinase inhibitor
Function (paralog2):hypothetical protein LOC100193847

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.44949497216391
Log2 mRNA fold difference:0.13087980294917
Log2 TE fold difference:0.27486343118442
Sequences
Protein sequence

MGKYMRKGKVSGEVAVMEVPGGALLGVRTRSRTLALQRAQRPLDKGDAEDAAAEYLELRS
RRLEKPHKEHPSPPATATKRGAGRKAAAAAAVQHVLMQDEVEVEVSFGDNVLDLDTMERS
TRETTPCSLIRNPEMISTPGSTTKSKTSSNSTTSRRRTEETPSCRFIPSSLEMEEFFSAA
EQQEQHSFREKYNFCPVNDCPLPGRYEWARLDC*

MGKYMRKGKMSGEVAVMEVPGGALLGVRTRSRTLALQRAQRPLDKGDADDAAGQYLELRS
RRLEKPHKEHQPLPPPPPAPAAKRGAGRKAASAAAAPHALAEDEVEVEVSFGENVLDLDA
MERSTRETTPCSLIRNPEMISTPGSTTKSKTSNSTTSRRRMETSVCRFIPSSLEMEEFFS
AAEQQEQHNFREKYNFCPVNDCPLPGRYEWARLDC*

Other information
Ka divergence:-0.1784KaKs divergence:0.0479317
GC content 1 (%):64GC content 2 (%):63GC content divergence:-0.008
Length 1 (bp):642Length 2 (bp):648Length divergence:0.005
MFE 1 (kcal):-270.06MFE 2 (kcal):-269.96MFE divergence0