Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G157855-GRMZM2G022175
Species:maize
Duplication type:WGD
Function (paralog1):RHC1A
Function (paralog2):hypothetical protein LOC100192058

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MSTPAAAAKQYFCYQCNRTVLIAASAVAAGELSCPECHGNFLEEVTIPAPTFIQLPFPFA
STTIPTASTAPRPAPAAGTGRPPSFSSSSAATSRSEPRYISSILNSFVGPGEQPNRISGS
SIRFAPGTATHRNEPEPFDPVMFFQNYIQSLVEGGANIQVLFDDASASLGSGPGLGRLGG
ASFGDYFVGPGLEQLIEQLAENDPNRYGTPPAAKSALSSLPDVVVTHTMVAAAEGAECAV
CKEDFSPGEVAKQMPCNHIYHTDCIMPWLELHNSCPICRFELPTDDPDYEVRKGSNSQQA
VGIAAAASGSSTAAEGQMERQENPRVVERRFNVSLPWPFSGLGGQTSQQDGNSGGSGSNS
QGSGSQDGGPPSSKN*

MSTPAAAYYAAAARKQYFCYQCNRTVLIAASAAAAGELSCPECHGDFLEEVTVPAPTFIP
LPFPFPFAPTTIPAASTTPAPAPAAGSGGSPSLSSSSSSAATSPSQPNDISSILNSFLGL
GEQPIRVGGSASRAAAGTATPENEPEPFDPVMFFQNYIHSLVEGGANIQVLLDDASVTLG
SGPGLGRIGGASFGDYFVGPGLEQLIEQLAENDPNRYGTPPAAKSVLSSLPDVLVTHAMV
AAAEGAECAVCKEDFSPGEVAKQMPCKHIYHTDCIVPWLELHNSCPICRFELPTDDPDYE
GRKGTNPQPAVGVAAAASGSSTAAEGQMEERQENPRVVERRFNVSLPWPFSGLGGQTSQQ
DGNSGGSGSNSQGNAQDGDPPSNKN*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):62GC content 2 (%):64GC content divergence:0.016
Length 1 (bp):1128Length 2 (bp):1158Length divergence:0.013
MFE 1 (kcal):-450.83MFE 2 (kcal):-482.71MFE divergence0.034