Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G157927-GRMZM5G830949
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100273982
Function (paralog2):hypothetical protein LOC100192736 (LOC100192736), mRNA

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.02452481930491
Log2 mRNA fold difference:-0.2810207960926
Log2 TE fold difference:0.24928912985914
Sequences
Protein sequence

MQEALVSPANAGRLRSALELKPFAFGDQRLASPRYLNLASVAGGGGGDDALFRCSSPFSP
SFGFSSPSPLATSSTISLSPSSSSSLVGDCDCDDDADADAATGHRLQLARLALQYQEVAD
RYELCLARLADAADEAAALRRENAELRVANGDLTRRLALLSGIGKQAAAAAIADEVRRLR
FGEQKAAKERAPEKPAVLPKSISVRSNDYLKMNQPQQVQAPATPAEDNRKPRASNPTTNR
SSQRVYKGNGGDKRSEEPKEHRTAGGVELEVYNQGMLKTELCNKWEETGACPYGDQCQFA
HGVAELRPVIRHPRYKTQVCRMVLAGEVCPYGHRCHFRHTLTPAERLHLPRP*

MQEALVSPANAGRLRFRSGLGAQAVRLRGPAPRLAALPQPQPQPRRRPMTRCSAARRRRS
APASASPPRRRRSPRPPSRSRRPPPPPSPTTAATAPGTDADADAATGHTLRLARLALQYQ
EVADRYELCLARLADAADDAAALRRENAELRNANADLTRRLALLSGIGKQVAAAAAAAEE
ARRLRFGEPKAVPAAKDCATEKPAVLPPKSISVRSIDFLLKMNQPKQVQPPATTPAASNR
KHRASNPTKPSSRVYKGNGGEKKDEELPKEQHAAGGVELEVFNQGMLKTELCNKWEETGA
CPYGDQCQFAHGVAELRPVIRHPRYKTQVCRMVLAGEVCPYGHRCHFRHTLTPAERLHLA
CP*

Other information
Ka divergence:0.799619KaKs divergence:-0.804089
GC content 1 (%):70GC content 2 (%):70GC content divergence:0
Length 1 (bp):1059Length 2 (bp):1089Length divergence:0.014
MFE 1 (kcal):-466.1MFE 2 (kcal):-469.83MFE divergence0.004