Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G158062-GRMZM2G099487
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100273768
Function (paralog2):hypothetical protein LOC100383319

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MKAEVDHDVHQNAMTAKTGVLGADAESKVAERPRLNLKPRSYATGQSDEMAVKERPSLFG
GARPREQVLKERGVDVLASDLERISPVGRSKGEFAKVEQKVEALSINPSLERADGFSAGH
RGPRSVDKKDYRRDTEKADAYRPSRREDNRRVARDMEKPQEQPRPEPETWRKPVEPPKPE
VATPRFGKAATALELAQAFSTSMSDTAPQNRLTSVPSPRVPLSPGARDQSGFSRLTDSRT
LRSSPSQRKINGY*

MSKKKAVTTMTLKDFHGGSIPSELPLPSAPGVTPRPADRTVASASPVAAAVARPRVPVAS
PAAAAAAAAMPSFLTNPSRIGRHFDEDERTPFEPTTPRRPAPSPTSFAPAPVVAPTRSGP
GNAWGPKKEASSAPSPVGHAPASAGDQIWSATRIAQASAVEKVISGRWHPPKPTSPPAPV
SVPVLETPVAPPEIERPRSVGVRELDSGVERGAAPVRPASHEGRIGEGRAGEVPERPKLK
LLPRSKPIEDPEQRPTYVEAKQVHQVQVTAGLMKAEDNHDLHQNARATETGVLGADAESR
VAERPRLNLKPRSYVTGQSDEIAVKERPSLFGGARPREQVLKERGVDVLASDLEKTSPVG
RPKGEFAKVEQKVEAMSINPSVERHESFAAGHRGPRNGDKKDHKWNTDRADAYRLTRRED
NRRVARDMEKPQEQPRPEPETWRKPVEPPKLEVATPRFGKAATALELAQAFSTSMSDTAP
QSRLTSAPSPRVPPSPGASRDQSGFSRLTDSRTLHSGPSQRKINGY*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):51GC content 2 (%):59GC content divergence:0.073
Length 1 (bp):762Length 2 (bp):1581Length divergence:0.35
MFE 1 (kcal):-258.4MFE 2 (kcal):-624.51MFE divergence0.415