Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G158162-GRMZM2G172621
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100382023
Function (paralog2):hypothetical protein LOC100216901

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-2.924014828232
Log2 mRNA fold difference:-2.6760378499862
Log2 TE fold difference:-0.24952808544978
Sequences
Protein sequence

MAMAGAGAAAAAAKRCMNPACGALPASSVVVGAGGDWRKGWPLRSGGFALLCDKCGLAYE
QFVFCDIFHQKESGWRDCSFCGKRLHCGCVASKNSYDLLDSGGIQCVTCMKNSAAQSASG
QVVPKLFPCPNNLLFFGKSDELLSSRKFEQPPSLMLDSRNDDIAIVNKSSHLFMVSGIEA
GQSSNILRQKEIENGPRQIKWEQPTLNIGDMGRPLLTRSQSALESPQCTRRDDNKDPTTD
STTSESFPEACLSMNLGIANNGNRMEATSTAERPMLSPTTAIAEGRELTTALSPFQHAQR
ARHFLTRPPRVGEGAAFDPTRDMFPHLRVARPPAEGRGRNQLLPRYWPRITDQELQQISG
DSNSTIVPLFEKVLSASDAGRIGRLVLPKACAEAYFPPISQPEGRPLTIQDARGKEWHFQ
FRFWPNNNSRMYVLEGVTPCIQSLQLQAGDTVTFSRIDPGGKLVMGFRKATNTVSLPDSQ
ISAIANGSLLSETLFSTANESIGVVSGYPGFLHSIKGAADFHPSSLYDHHINSADGDVSW
NKADKFGSRPDEGSLQFLQKRSRNIGSKSRRFLIDAEDAMELKLTWEEAQELLRPAPTAK
PTVVMIEDYEFEEYDEPPVFAKRSIFTIRATGEQDQWIQCDECSKWRRLPLNVIVASKWT
CTDNSWDPKCCSCSAPEELTPKELQSVMQQYEEMRRRKGSYGLKLNVAEMDASSFDALAT
GAVFGEVGNQGTASVATTTRHPRHRPGCTCIVCIQPPSGKGPKHNPACTCNVCMTVRRRF
KTLMMRKKQRQSEREEAEASKKIAWVNRDEPEGSSLSRSPQTLDTTRDSSDVTMFDKVAA
DVNKGHIDLNFHPAAPAVRGAGDQGQNGAQQPRAVSMMGLLEVASRPLDNYMKQNGLTSL
AGEQGGGSSSTATVPPAPVESEDRTSDEGRVASAEREADAMAIDEAGENQQDKPADSAAA
AAT*

MAMAAAAAAATKRCMNPACGAPASVLGAGGDWRKGWPLRSGCFALLCDKCGLAYEQFVFC
DIFHQKESGWRDCSFCGKRLHCGCVASKNSYDLLDSGGVHCVTCMKNSLAQSASGQVVPK
LFPSPINLRFFGKSDELLSSRNFEQPPSLTLDSRNDDIAFVNKSNHLFMVKGIEAGQSSN
ILRQKEIENGSRQIKWEQPTLSFGDMGRPFLTRSQSALESPQCTRRDDNKDPTTDSTSES
FSEACLSMSLGIANNVNRMEATSTAERPVLLSTTAIAEGRELATTLSPFQHAQRARHFLT
RPPRIGEGAAFDPTRDMFPHLRVARPPADGRGRNQLLPRYWPRITDQELQQISGDSNSTI
VPLFEKVLSASDAGRIGRLVLPKACAEAYFPPISQPEGRPLTIQDARGKEWHFQFRFWPN
NNSRMYVLEGVTPCIQSLQLQAGDTVTFSRIDPGGKLVMGFRKATNTVSLPDSQISAIAN
GSLLSETLFSTANENIGVVSGYPGFLHSIKGAADLHPNSLYDHHMNLVDGDVSWNKADKF
GSRPDEGSLQFLQKRSHNIGSKSRRFLIDAEDAMELKLTWEEAQELLRPAPTAKPTVVMI
EDYEFEEYDEPPVFAKRSIFTIRATGEQDQWIQCDDCSKWRRLPLNVIVAPKWTCTDNSW
DSKCCSCSAPEELTPRELQSVLQQYEEMRRRKGSYGLKLNVAEMDASSLDAFATAAVFGE
VGNQGSASVATTTKHPRHRPGCTCIVCIQPPSGKGPKHSPACTCNVCMTVRRRFKTLMMR
KKQRQSEREEAEAGKKIAWVNRDEPEGSSLSRSPQTLDSTRDNSDVTATMLDKVSDVNKQ
GHIDVDLNLHPAAPAVQAAQQQPRPVSMMGLLEVAGRPLDNYMKQNGLTSLVGEQGGGSS
STATVPPPALVESEERTSNEGLVPSASAEREPNAMAVDEAGENQQDKAADDDDDAVAAAA
T*

Other information
Ka divergence:0.244985KaKs divergence:0.151319
GC content 1 (%):51GC content 2 (%):51GC content divergence:0
Length 1 (bp):2892Length 2 (bp):2886Length divergence:-0.001
MFE 1 (kcal):-1049.92MFE 2 (kcal):-1052.35MFE divergence0.001