Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G158304-GRMZM2G473709
Species:maize
Duplication type:WGD
Function (paralog1):Ubiquinol-cytochrome c reductase complex 6.7 kDa protein
Function (paralog2):hypothetical protein LOC100383622

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MALPASSSGLFRFVSPRSRPQSTDIVAAASWGVFAGTAGLYLVQPFDWIKKTFFQKPEPE
A*

MALPASSSGLFRFVSPRSRPQSTDIVAAASWGVFAGTAGLYLVQVRINRPARISYPPLAL
LDRGSSHVYKARRLSSRLLCVIFDESSGSADVISFLGIRFPAW*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):61GC content 2 (%):60GC content divergence:-0.008
Length 1 (bp):186Length 2 (bp):312Length divergence:0.253
MFE 1 (kcal):-61.5MFE 2 (kcal):-107.57MFE divergence0.272