Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G158568-GRMZM2G011253
Species:maize
Duplication type:WGD
Function (paralog1):60S ribosomal protein L31
Function (paralog2):60S ribosomal protein L31

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAEKKRGAGTRKDEVVTREYTINLHKRLHGCTFKKKAPNAIKEIRKFAQKAMGTTDVRID
VKLNKHIWSSGIRSVPRRVRVRIARNRNDEEDAKEELYSLVTVAEIPPEGLKGLGTKVVE
DED*

MSERRRGAGAGTGTRKDEVVTREYTINLHKRLHGCTFKKKAPNAIKEIRKFAQKTMGTTD
VRIDVKLNKHVWSSGIRSVPRRVRVRIARKRNDEEDAKEGQYSLVTVAEIPPEGLKGLGT
KVVEDED*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):54GC content 2 (%):59GC content divergence:0.044
Length 1 (bp):372Length 2 (bp):384Length divergence:0.016
MFE 1 (kcal):-125.8MFE 2 (kcal):-149MFE divergence0.084