Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G159200-GRMZM2G323828
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.38667257347527
Log2 mRNA fold difference:-2.8104505502971
Log2 TE fold difference:3.2583063715938
Sequences
Protein sequence

MKATSSQRRALQFGCPRYVVHNKTNRLSMHMNYYSAEKKLHGPWCDLTLLPLVIPQENMD
GDGSIMTNDSRDCGQRYPMMNQEPARRPPPMGQRYDPEPCWRQSRPQELSNGQTKEQFVA
EMLARPSSVESGPGRPQARPRQQHQDTPAAQARPQPAASEKPAAQLDANSVRAKLELAKN
AKLEATKRKLQEGYQESDNAKKQRNVQMVGPQNLPKQGNTNNNRSFQPSGSGRPRSSGNV
NSNRNWSR*

MAPPSRDYWLGFFRGAGDNIFDAIEAAITVAASDHPAALRERRDGIAERLFTALLVTSAA
AAAAGAAAAAPGGGAAGGTPVAGAPTPAQLHPEGAASVPSLCSSDRAEAIADDAAPRCDD
PVLAETERIKAVLLSDQEKPEAELLELLRRLQELDLAFDTLDATAIGKAVANFRKHSSKQ
IRNLVRSLIEDWKHTVDVWIAHRRDAVVDQTPQSMGPSSLEQEDRGAASTHMDEGDLFAT
PSTTIRLSEENMDGDGSIMTNDSRDCGQRYPMMNQEPARRPPPMGQRYDPEPCWRQSRPQ
ELSNGQTKEQFVAEMLARPSSVESGPGRPQARPRQQHQDTPAAQARPQPAASEKPAAQLD
ANSVRAKLELAKNAKLEATKRKLQEGYQESDN

Other information
Ka divergence:-0.993076KaKs divergence:0.998918
GC content 1 (%):58GC content 2 (%):66GC content divergence:0.065
Length 1 (bp):747Length 2 (bp):1176Length divergence:0.223
MFE 1 (kcal):-272.3MFE 2 (kcal):-541.2MFE divergence0.331