Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G159307-GRMZM2G058491
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MERKSVVMSALGIGIGVGVGLGLASAPWAGGASASASARAAGVTVERVEQDLRRLLADGA
DSKVTFDEFPYYLSEQTRVVLTSAAYVHLKQAEISKYTRNLAPASRAILLSGPAELYQQM
LARALAHYFQAKLLLLDPTDFLIKIHNKYGTGGGTEKTFKRSISETTLERVSGLFGSLSI
LPQKEQPKGTIRRQSSMTDVKLRSSESTSNLPKLRRNASSSSDMSSMASQGPSTNTAPLR
RTSSWTFDDKILVQALYKVLLSVSKSYPIVLYIRDVEKFLHKSPKMYLLFEKLLNKLDGP
VLVLGSRIVDMESDEELDYRLTVLFPYNIEIKPPENENHLVSWKSQLEEDMKMIQFQDNR
NHIMEVLAENDLECDDLGSICLSDTMCLSKYIEEIVVSAVSYHLMNNKDPDYRNGKLVLS
TKSLSHASEIFQGNKMTDKDSMKLEVTDGTLKASEKAIAPTTAKSETKPASSLPPVRPPA
AGAPAPRVESKTELEKKDNPPPSAKVPEGTADNEFEKRIRPEVIPANEIGVSFDDIGALD
DIKESLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIANEAQASFINVS
MSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRNRAGEHEAMRKIKNEFM
THWDGLLSRSDQRILVLAATNRPFDLDEAIIRRFERRIMVGLPSMESRELIMRRLLSKEK
VDERLNFKELATMTEGYSGSDLKNLCTTAAYRPVRELIQKERKKELEKLKREKGETPSDL
PKKKEETITLRPLSMTDLKEAKNQVAASFASEGVCMSELRQWNELYGEGGSRKKEQLTYF
L*

MEAKSVVMSALGIGIGVGVGLGLASAPWAAGASASSRAAGVTVDRVEQDLRRLLVDGADT
KVTFDEFPYYLSEQTRVVLTSAAYVHLKQADISKYTRNLAPASRTILLSGPAELYQQMLA
RALAHYFQAKLLLLDPTDFLIKIHSKYGTGGSTEKTVKRSISETTLERVSGLLGSLSILP
QKEQPKGTIRRQSSMMDVKLRSSESMSNLTKLRRNASTSSDMSSMASQGPSTSTAPLRRS
SSWTFDEKILVQALYKVLLSVSKKYPVVLYIRDVEKFLHKSPKMYLLFEKLLNKLEGPVL
ILGSRIVDMNSDEESDDRLTVLFPYNIEIKPPENENHLVSWNSQLEEDMKMIQFQDNRNH
IMEVLAENDLECDDLGSICLSDTMCLSKYIEEIVVSAVSYHLMNNKDPEYRNGKLVLSTK
SLSHALEIFQGNKISDKDSMKLEATDDALKAAEKATAPTTAKSETKSATSLPPARAPAAA
AAAPASAPAPRIESKTELEKKDNPPPVAKAPEVTPDNEFEKRIRPEVIPANEIGVSFDDI
GALDDIKESLQELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIANEAQASF
INVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRNRAGEHEAMRKIK
NEFMTHWDGLLSRPDQRILVLAATNRPFDLDEAIIRRFERRIMVGLPSMGSRELIMRRLL
SKEKVDEGLDFKELATMTEGYSGSDLKNLCTTAAYRPVRELIQKERKKELEKLKCEKGET
PSDPPKKEKEETIILRPLNMTDLKEAKNQVAASFAAEGAIMSELRQWNELYGEGGSRKKQ
QLTYFL*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):2526Length 2 (bp):2541Length divergence:0.003
MFE 1 (kcal):-807.15MFE 2 (kcal):-810.47MFE divergence0.002