Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G159388-GRMZM2G359018
Species:maize
Duplication type:WGD
Function (paralog1):seed maturation protein
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.7271191584922
Log2 mRNA fold difference:-0.60682276480939
Log2 TE fold difference:-1.1226949581332
Sequences
Protein sequence

MAEQTQPQGEGGASPKHESLMEKLADKLHVGGGKADSSSSSDSDSDERPRPSAPPADELK
QPSFSDAAATAAAEAKAKVFRLFGREQPIHKALGGGKPADVFLWRNKNISAGVLGGATAI
WILFELLGYHLLTFVCHGLIFALGVLFLWSNASSFIHKAPPKIPEVIIPEDLVVNIALST
RYEINRAFANLRQIALGRDLKKFLMVIAGFWLLSVLGSCCNFLTLVYIVFVVLHTVPVLY
EKYEDQIDSYGEKGWVEIKKQYAVFDEKVLSKVPRGPAKDKKH*

MAEQPQEGGASPKHESLMEKLADKLHVGGGKGDSSSSDSDRDEPPHPSAPPTDEVKQPSF
SDSTATAAAEAKAKVFRLFGREQPIHKALGGGKPADVFLWRNRNISAGVLGGATAIWILF
ELLGYHLLTFVCHGLIFSLGVLFLWSNASSFIHKSPPKIPEVVIPEDLVVNIAVSTRYEI
NRAFANLRRIALGRDIKKFLMVIAGLWLLSVLGSCCNLLTLVYIVFVVLHTVPVLYEKYE
DQIDTYGEKGWVEIKKQYAVFDEKVLSKVPRGPAKDKKH*

Other information
Ka divergence:0.164832KaKs divergence:0.269612
GC content 1 (%):55GC content 2 (%):55GC content divergence:0
Length 1 (bp):852Length 2 (bp):840Length divergence:-0.007
MFE 1 (kcal):-322.1MFE 2 (kcal):-313.84MFE divergence-0.013