Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G159924-GRMZM2G020785
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100273331
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAMAVASFVAASHHHGSHLAAGVPFSARVGRSLGRSGVTIYMRAQKKRNSESGSSSGGGD
VRASSGRRVWRRRKLTKEDDMLRYKLDRIPFLEEKVRKVRENGKIICLDINQLMLSQENR
FAFTMEVAEEANVYLEKNRHEYGLKKPILHVLSDRMNEAGFSRPEGYLYPYPIKPGPYFI
KEEGN*

MASFVAATHHHGSHLAAGFPYSARAGRSVGRSGVTISIRAQTKEDDMLRYKLDRIPFLEE
KVRKVRENGKIICLDINQLMLSQENRFAFTMEVAEEANAYLEKNRHEYGLKKPILHVLSD
RMNESGFSRPEGYLYPYPIKPGPYFIKEEGN*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):51GC content 2 (%):48GC content divergence:-0.03
Length 1 (bp):558Length 2 (bp):456Length divergence:-0.101
MFE 1 (kcal):-207.1MFE 2 (kcal):-141.63MFE divergence-0.188