Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G160237-GRMZM2G053199
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100272981
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAAAPAAGGQGGGGMDAALLDDIIRRLLEVRTARPGKQVQLSESEIRQLCTVSREIFLNQ
PNLLELEAPIKICGDIHGQYSDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLA
YKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNVRLWKVFTECFNTLPVAALIDDKI
LCMHGGLSPDLAHLDEIKNLQRPTDVPDQGLLCDLLWSDPGKDAQGWGMNDRGVSYTFGA
DKVSEFLQKHDLDLICRAHQVVEDGYEFFADRQLVTIFSAPNYCGEFDNAGAMMSVDETL
MCSFQILKPAERKNKFMGSNKM*

MSAAPAAGGQGGGGIDAALLDDIIRRLLEVRTARPGKQVQLSESEIRQLCTVSRAIFLSQ
PNLLELEAPIKICGDIHGQYSDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLA
YKIKYPENFFLLR

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):47GC content 2 (%):55GC content divergence:0.078
Length 1 (bp):969Length 2 (bp):399Length divergence:-0.417
MFE 1 (kcal):-328.6MFE 2 (kcal):-143.5MFE divergence-0.392