Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G160324-GRMZM2G164136
Species:maize
Duplication type:WGD
Function (paralog1):LOC100283137
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.5260835832985
Log2 mRNA fold difference:-0.33470675081283
Log2 TE fold difference:0
Sequences
Protein sequence

MEAHASRGRRTLEEIRQKRAAERMQHAVPIAASHVDSHGNQRAGAEHLARVQELENGNTE
LERENKMLLSKIAEKEVEKDALVNRLNDLERNVVPSLKKSLNDIYLEKDAAVVAKEDALA
QLRSMKKRLKEAEEEQYRAEEDSASLRAQLNTLQQQMGHTYSGYTMGTSSEESVAMEKEI
QDLQAQLKQESLLRQQEQQQLAEQSQLRQQEQEKLAKEQTRIASLEAEKQQLEDQITMLT
KKATEDASEFAARKAFSMQDREKLEQQLHDMALMIERLEGSRQKLLMEIDSQSSEIEKLF
EENSALSASYQEAIDVTVQWENQVRDCLKQNEELRSHLEKLRLEQVSLLKVSNIATQSDG
QTENSISNPPQMVIENISLKDQLIKEQSRSEGLSAEIMKLSAELRKAVHAQNNLARLYRP
VLRDIESNLMKMKQETYATIQ*

MEAHASRGRRTLEEIRQKRAAERMQHALPIAASHVDSHGNQRAGAELLARVQELENGNTE
LVRENKMLLSKIDEKGVEKDALVNRLNDLERNVVPSLQKNLNDISLEKDAAVVAKEDALA
QLRSMKKRLKEAEEEQYKAEEDSASLRAQLNTLQQQVMGHSYSGYTMGISTEESVAMEKE
IQDLQAQLKQESLLRQQEQQKLAEESQLRQQEQEKLAKEQIHIASLEAEKQQLEDQITML
TKKATEDASEFAAHKAFSMQDREKLENQLHDMALMIERLEGSRQKLLMEIDSQSSEIEKL
FEENSALSTSYQEAIAITVQWENQVRDCLKQNEELRSHLEKLRLEQASLLEVSNITTKSD
GQIENSISNLPEMVTENISLKGQLIKEQSRSESLLAEIMKLSAELRKAVQAQNNLVRLYR
PVLRDIESNLMKMKQETYATIQ*

Other information
Ka divergence:0.153846KaKs divergence:0.0174885
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):1326Length 2 (bp):1329Length divergence:0.001
MFE 1 (kcal):-402.39MFE 2 (kcal):-386.5MFE divergence-0.02