Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G160417-GRMZM2G393897
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100382638
Function (paralog2):hypothetical protein LOC100191621

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.71862345620826
Log2 mRNA fold difference:-0.5976785142145
Log2 TE fold difference:-0.077500877686942
Sequences
Protein sequence

MNGGAAPPSAAAAATPPHRRLPDFLQSVNLKYVKLGYHYLITHLLTLMLLPLMAVILLEA
GRTDPEDLRQLWLHLQYNLVSVLVLSAVLVFGATVYVLTRPRPVYLVDFACYKPPAHLQV
RFEEFMRHSKLCGFSDDALEFQRKILERSGLSEETYVPEAMHALPPQPTMANARAEAETV
MFGALDSLFRSTGVRPKDVGVLVVNCSLFNPTPSLSAMIVNKYKLRGNVRSFNLGGMGCS
AGVIAVDLARDMLQVHRGTYAVVVSTENITQNWYFGNRKSMLIPNCLFRVGGAAVLLSNR
GGDRRRAKYVLRHVVRTHKGADDRAFNCVYQEQDGEGKTGVSLSKDLMAIAGGALKTNIT
TLGPLVLPVSEQLLFFATLVAKKLLVSAKTKPYIPDFKLAFEHFCIHAGGRAVIDELEKN
LQLSPAHVEASRMTLHRFGNTSSSSIWYELAYMEAKGRVRRGHRVWQIAFGSGFKCNSAV
WHALRNVKPSPDSPWEDCIDRYPVELVDGFPAHQ*

MDGVSAPPPHRRLPDFLQSVNLKYVKLGYHYLITHLLTLTLLPLIAVILLEAGRTDPDDL
RQLWLHLQYNLVSVLVLSAVLVFGATVYALTRPRPVYLVDFACYRPPAHLRVRFDQFMRH
SRLCGFSDDALEFQRKILERSGLSEETYVPEAMHALPPQPTMANARAEAEAVMFGALDAL
FRSTGVKPKDVGVLVVNCSLFNPTPSLSAMVVNRYRLRGNVRSFNLGGMGCSAGVIAVDL
ARDMLQVHRATYAVVVSTENITQNWYFGNRKSMLIPNCLFRVGGAAVLLSNRGADRRRAK
YVLRHVVRTHKGADDRAFGCVYQEQDGEGKTGVSLSKDLMAIAGGALKTNITTLGPLVLP
VSEQLLFFATLVAKKLLSAKTKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLSPAHVE
ASRMTLHRFGNTSSSSIWYELAYMEAKGRVRRGHRVWQIAFGSGFKCNSAVWHALRNVKP
SPDSPWEDCIDRYPVELVDGFPTQQ*

Other information
Ka divergence:0.672283KaKs divergence:0.565836
GC content 1 (%):67GC content 2 (%):68GC content divergence:0.007
Length 1 (bp):1545Length 2 (bp):1518Length divergence:-0.009
MFE 1 (kcal):-728.1MFE 2 (kcal):-708.54MFE divergence-0.014