Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G160428-GRMZM2G164160
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100382597

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.4319228256433
Log2 mRNA fold difference:-1.8673774330542
Log2 TE fold difference:0.43654484780071
Sequences
Protein sequence

MGDGASGRGGRSGAGRRVGEYELLRPIGSGAYSQVWLGRHRVRGTEVAVKEIAMERLSKK
LRESLLSEVDILRRIRHDNVIALHDSVKDHGSIYLILEYCRGGDLHAYLQRHKRVSEKVA
KHFIRQLASGLKMLRDNNVVHRDLKPQNILLVENNENTLLKIADFGFAKFLQPFALAETL
CGSPLYMAPEVMQGQKYDAKADLWSVGVILYQLVTGIPPFNGDNQIQLLKNILRTHEIRL
PSDCELSHDCIDLCRKLLRLNSVERLTVEEFVHHPFLSEHAPERTLSRTLSEIRDGFPIN
NISPTRPSSQSSQEDCMPFPLDDESSGQDEGPIPDSKSPMKSYGFPTGKRLDKTSGQSPS
KHTSLFSRYVLGNNHAPSSQHHGHTDKMTKESKIHEVQGPKGVYPEGMEVISSAIPHFYY
EQSLLKLLFHYFVNVDSPIIDSLEFVDQEYVFVSGPHPEGSSSSTNASQQLNLPAKYDNL
SVSPPKLTFLSAPMPINGLPINRQQSAGTGSFDSHYSPASVISQGSADISDAMDQPPSDY
LTRIRLLEQYASAIAGLVRDEIKGGRHLVAFSIQLIVLATWKQAIHLCNTFVASLARESP
SQDIHMKGLSADASHLLANSKLADDVCVQIEKQFLSEVEYAEELASTVGQIADGTEMPDA
IEMIFQSALLTGRRGGVDEMFGKAADAMTGYTRAVSMLRFLLIEAPSLALNPPLTLTRSD
RHRLRTYIEALNTRLCQMQSQRH*

MGDGASGRGGGGGAGRRVGEYELLRPIGSGAYSQVWLGRHRARGTEVAVKEIAMERLSNK
LRESLLSEVDILRRIRHDNVIALHESIKDHGSIYLILEYCRGGDLHAYLQRHKRVSEKVA
RHFIRQLASGLQMLRDNNVVHRDLKPQNILLVENNENSLLKIADFGFAKFLQPFALAETL
CGSPLYMAPEVMQAQKYDAKADLWSVGVILYQLVTGRPPFNGGNQIQLLKNILRTCEIRF
PSDCDLSHGCIDLCRKLLRLNSVERLTVEEFVHHPFLSEHAPEKTLSLTQSDIRDGFPRN
NSSPTRHSNHSSQEDCMPFPLDDESSGQDEGPVPDSKSLMKSYGFPMGKRLDKTSGQKSP
PKHNSLFSRYVLGNNHAPSSQHHGHSGKVTKESKIHEVQGQKVVYPEDQEYVFVSGPHLE
GSSSSTNASQQLNVPAKYDNSSVSPPKLTFMSAPMPINGLPINRQQLAGTGSFDSHCSPA
SGTSQGSADISDAMDQPPSDYLTRIRLLEQYASAIAGLVRDEIKGGRHLEAFSIQLIVLA
TWKQAIHIGNTFVASPARESPSQDIPMKGHIAGASHLPANSKLADDACMQIEKQFLSEVE
YAEELASIVGQIADGTEMPDAIEMIFQSALLIGRRGGVDEMFGKAADAMTGYMRAVSMLR
FLLVEAPSLALNPPLTLTRSDRNRLRTYIDALNTRLCQMQSQRH*

Other information
Ka divergence:0.105257KaKs divergence:0.177179
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):2232Length 2 (bp):2115Length divergence:-0.027
MFE 1 (kcal):-722.12MFE 2 (kcal):-713.68MFE divergence-0.006