Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G160430-GRMZM2G160460
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100274323
Function (paralog2):solute carrier family 2, facilitated glucose transporter member 8

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.14775277946615
Log2 mRNA fold difference:0.18776503135118
Log2 TE fold difference:-0.09037225722162
Sequences
Protein sequence

MASNNGGAMQEPLLPKAPKSGGWLWKGTRPSASGDLPSSKAVLRPPRHVPALLCTLIVAL
GPVQFGFTSGYSSPTQDAVIRDLNLSISEFSAFGSLSNVGAMVGAIASGQMAKYVGRRGS
LMIAAVPNIMGWLAISFAKDTTFLYVGRLLEGFGVGVISYVVPVYIAEISPHNMRGALGA
VNPLSATFGVLLSYVLGLFFPWRLLALIGTLPCLLLVAGLFFIPESPRWLARMNMMDDCE
TSLQVLRGFDADITEEVNDIKIAVASANKSGTISFRELNQKKYRTPLILGIGLLVLQQLS
GINCIIFYSGSIFKAAGLNNSNLDTCLIGAISVLATGVTTTILDRAGRRILLIISSSGMT
LSLLAVAVVFCIKDNIAQDSDLYNILRIVSLVGVVAYVTAFSFGMGSIPWIIMSEILPVS
IKCVAGSFATLANWLTSFGITMTANLLLNWSAAGTFASYMMVSAFTLVFVILWVPETKGR
TLEEIQWSFQ*

MARSRTSGGGEYESGSDHDGALQKPLLPNSGSWYRMGMGSRQSSLNAAGTSSMAVLRESH
VSAFLCTLIVALGPIQFGFTGGYSSPTQASIIRDLNLSISEFSVFGSLSNVGAMVGAIAS
GQMAEYVGRKGSLMIAAIPNVIGWLAISFAKDSSFLYMGRLLEGFGVGIISYVVPVYIAE
ISPQNMRGALGSVNQLSVTLGIMFAYLLGLFVPWRLLAVIGTLPCIVLIPGLFFIPESPR
WLAKMNMMDDCETSLQVLRGFDADITAELNDIKRAVMSANKRATIRFQELNQKKYRTPLI
IGIGLLVLQQLSGINGILFYASSIFKAAGLKDSDLDTFALGAIQVLATFVTTMFLDRAGR
RILLIISSAGMTLSLLVVAIVFYIKDNISHDSDLYDILSMVSLVGVVAYVIAFSFGMGAI
PWIIMSEILPVSIKSLAGSFATLANWLTSFGITMTANLLISWSAGGTFTSYMIVSAFTLV
FVIVWVPETKGRTLEEIQWSFR*

Other information
Ka divergence:-0.633605KaKs divergence:-0.349993
GC content 1 (%):52GC content 2 (%):50GC content divergence:-0.02
Length 1 (bp):1473Length 2 (bp):1509Length divergence:0.012
MFE 1 (kcal):-525.73MFE 2 (kcal):-539.23MFE divergence0.013