Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G160838-GRMZM2G405094
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100193234
Function (paralog2):R2R3MYB-domain protein Fragment

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.51696619206798
Log2 mRNA fold difference:1.5224169857291
Log2 TE fold difference:-1.0473021468244
Sequences
Protein sequence

MYALRCTCTAPPCLSPPFCPGLSLSASPCYNSNQTKPNQSSGGASTQTQGEARASKHTRE
QRAGRQAAMGRSPCCEKAHTNKGAWTKEEDQRLIAYIRAHGEGSWRSLPKAAGLLRCGKS
CRLRWMNYLRPDLKRGNFTGDDDELIIKLHALLGNKWSLIAGQLPGRTDNEIKNYWNTHI
KRKLLSRGIDPQTHRPLSGGAGSALTTTSSTAGFPSPAPASRPTPTPPPAVVVPPNAIFA
RPAPSEDGHSSSGASTDAPRCPDLNLDLDLSVGPPPKTPAATPASQQRRRTTICLCYHLG
VRGGEACSCETASSLAGFRFLRPLEEGQYI*

MGRSPCCEKAHTNKGAWTKEEDQRLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWMNY
LRPDLKRGNFTDDDDEVIIKLHALLGNKWSLIAGQLPGRTDNEIKNYWNTHIKRKLLTRG
IDPQTHRPLSAAAALTAGLPSPARPPTVLFARPAPSEDGGHSSGGGSADHAPRCPDLNLD
LSVGPPCSPPKTPAAAASTPTSQQQQQQRTTTICLCYHLGVRSGEACSCKSPSPAAAGFR
FLRPLEEGQYI*

Other information
Ka divergence:-0.172769KaKs divergence:-0.863303
GC content 1 (%):69GC content 2 (%):71GC content divergence:0.014
Length 1 (bp):993Length 2 (bp):756Length divergence:-0.136
MFE 1 (kcal):-466.89MFE 2 (kcal):-362.04MFE divergence-0.126