Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G161611-GRMZM2G171613
Species:maize
Duplication type:WGD
Function (paralog1):protein kinase CK2 regulatory subunit CK2B3
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.94982946696738
Log2 mRNA fold difference:0.74246199981606
Log2 TE fold difference:-1.7078031688839
Sequences
Protein sequence

MYKQGGAGGGAGLDRKRINDALDKHLEKAVASPSTSRGSAGGGRDHHRLVVPSSVSSIPK
GRCSEGESDSDSEASDVSGSDGEDTSWISWYCNLRGNEFFCEVDDDYIQDDFNLCGLSSQ
VPYYDYALDLILDIESSHGDMFTEEQNELVESAAEMLYGLIHARYILTSKGLAAMLEKYK
NYDFGRCPRVYCCGQPCLPVGQSDIHRSSTVKIYCPKCEDIYYPRSKYQGNIDGAYFGTT
FPHLFLMTYEHLKPQKLSQRYVPRVFGFKLHKP*

MLEKYRNYDFGRCPRVYCCGQPCLPVGQSDIHRSSTVKIYCPKCEDIYYPRSKYQGNIDG
AYFGTTFPHLFLMTYEHLKLQKPLQRYVPRVFGFKLHKP*

Other information
Ka divergence:0.505333KaKs divergence:0.811605
GC content 1 (%):52GC content 2 (%):50GC content divergence:-0.02
Length 1 (bp):822Length 2 (bp):300Length divergence:-0.465
MFE 1 (kcal):-300.2MFE 2 (kcal):-78.5MFE divergence-0.585