Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G162145-GRMZM2G436835
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):hypothetical protein LOC100272707

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.0669652645166
Log2 mRNA fold difference:0.70574526105249
Log2 TE fold difference:0.36135076871417
Sequences
Protein sequence

MAGAVSALFLLDIKGRVLVWRDYRGDVSALQAERFFTKLLDKEGDSEVHSPVVYDDAGVT
YMFIQHNNVFLLTAARQNCNAASILLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE
MMDFGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVE
SVNILVNSNGQIVRSDVVGALKMRTYLSGMPECKLGLNDRVLLEAQGRATKGKAIDLDDI
KFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLIWVEAQIEKHSRSRIELMVK
ARSQFKERSTATNVEIEVPVPSDATNPNIRTSMGSAAYAPERDAMVWKVKSFPGGKEYMC
RAEFSLPSITAEEGAPEKKAPIRVKFEIPYFTVSGIQVRYLKIIEKSGYQALPWVRYITM
AGEYELRLI*

MAPVKMLIRPVGARQSGRVVAGSRAGAEHDHDPVALARDPGAGELAVVEEPVVLRLGVVS
EDDDGDEAQHARRHHLAVLGHRRVEVAAVQGSTYKPAKRGAPHRTASRSHRSVDVRKTPG
SCALLTLSTSVSGSRFQLRSNPASVPRRASTSGAGAAGEIREHSSPATPHRPWPQLAADR
ERRRRGRADPDPVGGKDLIAPTTMAGAVSALFLLDMKGRVLVWRDYRGDVSALQAERFFT
KLLDKEGDSEVHSPVVYDDAGVTYMFIQHNNVFLLTAARQNCNAASILLFLHRVIDVFKH
YFEELEEESLRDNFVVVYELLDEMMDFGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVT
NAVSWRSEGIRYKKNEVFLDVVESVNILVNSNGQIVRSDVVGALKMRTYLSGMPECKLGL
NDRVLLEAQGRATKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQV
KPLIWVEAQIEKHSRSRIELMVKARSQFKERSTATNVEIEVPVPSDATNPNIRTSMGSAA
YAPERDAMVWKIKSFPGGKEYMCRAEFSLPSITAEEGAPEKKAPIRVKFEIPYFTVSGIQ
VRYLKIIEKSGYQALPWVRYITMAGEYELRLI*

Other information
Ka divergence:1KaKs divergence:0.996205
GC content 1 (%):48GC content 2 (%):53GC content divergence:0.05
Length 1 (bp):1290Length 2 (bp):1899Length divergence:0.191
MFE 1 (kcal):-441.19MFE 2 (kcal):-715.92MFE divergence0.237