Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G162276-GRMZM2G429000
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100273254
Function (paralog2):GR1a protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.8996591094774
Log2 mRNA fold difference:1.6299686767638
Log2 TE fold difference:-0.72236465415896
Sequences
Protein sequence

MASKGVLFLALNLLFFTVANACGSCPTPTPPVEPPPPPPATPPPSSSSGKCPLNALKFGV
CVNALGLVKGEAGKVPAEPCCNLIKGLADFEAAVCLCTAIKGNVLGVVFDVPIKFNALVN
YCGKCVPKGYMCA*

MASKAVLFLALNLLFFTVANACGNCPTPTPPVEPPPPPPAATPPPSSSGKCPLNALKFGV
CADVLGLVKGEAGKVPAEPCCTLIKGLADFEAAVCLCTAIKANVLGVVIDVPIKLSALVN
YCGKCVPKGYLCA*

Other information
Ka divergence:-0.61532KaKs divergence:-0.289802
GC content 1 (%):62GC content 2 (%):65GC content divergence:0.024
Length 1 (bp):402Length 2 (bp):402Length divergence:0
MFE 1 (kcal):-147.4MFE 2 (kcal):-158.9MFE divergence0.038