Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G162396-GRMZM2G373554
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100275817

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.7498727906836
Log2 mRNA fold difference:-2.5486032819013
Log2 TE fold difference:1.280552540284
Sequences
Protein sequence

MAAVWWWWAPLPAWLTSSALWFLVVNAVVAAVAVLSSRPLPLQSPRCGAGVSLTRRASSA
VLQRLRSFSIFSFPSACLNYTTPSTFTQPDAATAAAQETEETSRTPTTAKPSPRALPLPL
PPSPLSPSVRAPAADDDVPSGMSMDEAYALALEARRRPDREREEEARRSEVDARAEEFIR
GFKEDLRQQRLNSILNYTKMLKQRAFGGGAGAGARRQPDARPDQL*

MATPWWWPSLLPAWLSSSALWFLVANAVVAAVAILSRRPPLPLPLPLPSPRRRRRSSGAA
AALTRRASSALLQRLRSFSIFAVPSACFNTTTPFPHPDAAQGTETEAPARTPASPLSSLG
RAPAADADEEDSEPGGMSMDEAYALALEARRRPDREREEAPRRSEVDAKPEEFIRGFEDH
QRQQRLNSIFNYTQMLKQRAAAARRQRQPDAPPDQL*

Other information
Ka divergence:0.151108KaKs divergence:0.0733094
GC content 1 (%):71GC content 2 (%):73GC content divergence:0.014
Length 1 (bp):678Length 2 (bp):651Length divergence:-0.02
MFE 1 (kcal):-334.62MFE 2 (kcal):-329.1MFE divergence-0.008