Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G162725-GRMZM2G178916
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.3129747209916
Log2 mRNA fold difference:-0.72735867265352
Log2 TE fold difference:-0.57922705579631
Sequences
Protein sequence

MAVPSPAPRSPRRPDAIVAPDPSSADVPPSLDFGDPASLAALRVLTDAGAATRLLHECVA
YQRGLDARLDALLARRADLDRAAASLLRSAPPLLSLAASDAAALKESSSTTAALADALSS
RVRHLDAAHSRADAALARAEAALDRSRALEAARRALAADDLAAAATAVHEFLAIDARFPT
DDDLRRDLLDMKRRLEGLARRRLAAVVDAQDHPAVLRLVRLFPLLGLADEGLQVYVAYLK
KVVALRARADFEHLAELTSATQPTSERPDFVGCLTRLFKDIVLAVEENDAVLRELRGDDG
VAYAIIELQEECDSRGTQILRRYADYRKLARLASDINSYTKNLLSVMGSMASAAGGSEGP
DPREIELYLEEILALTQLGEDYTEFMVNKIRGLRDVKPELGPRAMKAFRNGNFYKTEQDL
TGFYVIFEEFFMVENVRKAIRIDEPISDGLTTSMVDDVFFVLQSCCRRAASTASINSVLA
VLGGAMSLLSNEYQEALQWRMREPNLGAKLFLGGVGVQKTGEEIATALNNIDISSEYVLK
LRHEIEELCVEVFHTPADREKIKSCLSELGEVSASFKKILHSALEHLVASVVPRIRPVLD
TVATVSYELDDTEYGENEVNDPWVQKLILTVNTNVAWLQPVMTLNNYDSFVHLIIDFIVK
RLEVIMMQKRFSQLGGLQLDKEVRSLINHFSEMSQRPVRDKFSRLSQMSTILNFERVSEI
LDFWGDNAGHLTWLLTPAEVRRVLGLRIDFRPEAIAALRL*

MGDRRVLLVASPEVAVFGYDGVVSLASVQDAVDTVPLNNQTRTVIRIGPGVHQQQVRIPR
TKNFITLCGSSIKDTVICWDNRTTTCIKHTQPSGAIGTGTLSSATVIVEGDDFIAENVIF
KNSAPQSGQAAAVRVTADRCAFYDCRFLGWQETLHLHGGKQLLKNCYVEGSYDFIFGDSA
ALLEHCHIHCKSAGYITAHGRKSSSEPTGFVFFKCVITGNGEAAYMYLGRPWEPFGRVVF
AETFMDRCIEPAGWHNWDKPDNEQTACFYEYRCSGPGSSSSGRERWCKELFGDEAMPFLA
QTFIDPDIENPWLVHSKAVAVVGDLGDAQLVAHPDELLPEPPGSLLVQGEPTRQCKVNSR
FPAGVQSKSQTEKTAAAAYHRAAGRVAADGLLQRAAVEEDLLVVVVGENGVELPAGAEHR
EPGLRRRAVELQQPARVGGTAVSLHPAGCRPFILKFEDPGGASERSYYLLLQPTVPDLGA
LRASAASRRRLDHGREVEAGPGAYQRGRRVTDRERGARRVAAPSPVGQIVEQTPRGQWAA
ALLAYCLCLASVYPTTSRGPTVERGSRSTEYSEIWPVSTAFSSLTSTSCRSALTPRPAFM
AVTFPSPTPRSPRRPDAIVAPDPSSADMSPSLDFGDPTSFTALRVLTDGGAATRLLHECV
AYQRALDARLDALLARRADLDRAAASLLRSAPPLLSLAASDAAALKESSSSTAALADALS
SRVRHLDAAHSRADAALARAEAALDRSRALEATRRALAADDLAAAATAAHEFLAIDARFP
TDDDLRRDLIDIKRRLEGLARRRLAAVVDAQDHPAVLRLVRLFPLLGLADEGLQVYVAYL
KKVVALRARADFEHLAELTSATQPTSDRPDFVGCLTRLFKDIVLAVEENDGVLRELRGDD
VAYAIIELQEECDSRGTQILRRYADYRKLARLASDINSYTKNLLSVMGSMASAAGGNEGP
DPREIELYLEEILALTQLGEDYTEFMVNKIRVLRDVKPELGPRAMKAFRNGNFNKMEQDL
TGFYVIFEEFFMVENVRKAIRIDEPISDGLTTSMVDDVFFVLQSCCRRATSTASINSVIA
VLGGATSLLSNEYQEALQWRMREPNLGAKLFLGGVGVQKTGEEIATALNNIDISSEYVLK
LRHEIEELCVEIFHTPADREKIKSCLSELGEISASFKKILHSALEHLVASVAPRIRPILD
TVATVSYGLDDAEYGENEVNDPWVQKLILAVNTNVAWLQPVMTSNNYDSFVHLIIDFIVK
RLEVIMMQKRFSQLGGLQLDKEVRSLINHFSEMSQRPVRDKFSRLSQMSTILNFERVSEI
LDFWGDNAGHLTWLLTPAEVRRVLGLRTDFRPEAIAALRL*

Other information
Ka divergence:0.0286976KaKs divergence:0.213708
GC content 1 (%):56GC content 2 (%):56GC content divergence:0
Length 1 (bp):2283Length 2 (bp):4083Length divergence:0.283
MFE 1 (kcal):-896MFE 2 (kcal):-1639.6MFE divergence0.293